Bhi05M001693 (mRNA) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGGAAGGAAGAAAAGGAGGTTTGAAGGGATCGAAGGAGGGAAATGGTTTTTAATACATAATAATGACAAGAGAACACCTTGTCTTTTGTCTCCTTTGCCTATTTGATTATGAATCATAAATTATTATGTGGACCTCTCTTCTTTTGCTCTAAAAGTTTCAATAATCACAAATTATGTTGTCGTGGAAGTATGATGCTAATTGCTATTTACTTCTGAACATTTCAGGAGAATCTTCAACAATGGCTAACTCATGAAAAAGCATGGGATCAGTTTGTTAACCGATCTAGTTCCGATACTGAGGTTTTCTGGAATGATGCTAGACATTTGAAGCCTGAGCCTGTTTACAAGCGTCAAGTGAGTATCCTTTAG ATGAGGAAGGAAGAAAAGGAGGAGAATCTTCAACAATGGCTAACTCATGAAAAAGCATGGGATCAGTTTGTTAACCGATCTAGTTCCGATACTGAGGTTTTCTGGAATGATGCTAGACATTTGAAGCCTGAGCCTGTTTACAAGCGTCAAGTGAGTATCCTTTAG ATGAGGAAGGAAGAAAAGGAGGAGAATCTTCAACAATGGCTAACTCATGAAAAAGCATGGGATCAGTTTGTTAACCGATCTAGTTCCGATACTGAGGTTTTCTGGAATGATGCTAGACATTTGAAGCCTGAGCCTGTTTACAAGCGTCAAGTGAGTATCCTTTAG MRKEEKEENLQQWLTHEKAWDQFVNRSSSDTEVFWNDARHLKPEPVYKRQVSIL
BLAST of Bhi05M001693 vs. Swiss-Prot
Match: sp|P56821|EIF3B_TOBAC (Eukaryotic translation initiation factor 3 subunit B OS=Nicotiana tabacum OX=4097 GN=TIF3B1 PE=2 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 8.6e-12 Identity = 33/42 (78.57%), Postives = 35/42 (83.33%), Query Frame = 0
BLAST of Bhi05M001693 vs. Swiss-Prot
Match: sp|Q9C5Z1|EIF3B_ARATH (Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana OX=3702 GN=TIF3B1 PE=1 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 3.6e-10 Identity = 30/42 (71.43%), Postives = 32/42 (76.19%), Query Frame = 0
BLAST of Bhi05M001693 vs. TAIR10
Match: AT5G27640.2 (translation initiation factor 3B1) HSP 1 Score: 64.7 bits (156), Expect = 2.0e-11 Identity = 30/42 (71.43%), Postives = 32/42 (76.19%), Query Frame = 0
BLAST of Bhi05M001693 vs. TAIR10
Match: AT5G25780.1 (eukaryotic translation initiation factor 3B-2) HSP 1 Score: 63.9 bits (154), Expect = 3.4e-11 Identity = 29/42 (69.05%), Postives = 33/42 (78.57%), Query Frame = 0
BLAST of Bhi05M001693 vs. TrEMBL
Match: tr|A0A1S3BIW9|A0A1S3BIW9_CUCME (Eukaryotic translation initiation factor 3 subunit B OS=Cucumis melo OX=3656 GN=LOC103490196 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 5.8e-13 Identity = 38/42 (90.48%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Bhi05M001693 vs. TrEMBL
Match: tr|A0A1S3BJ74|A0A1S3BJ74_CUCME (Eukaryotic translation initiation factor 3 subunit B OS=Cucumis melo OX=3656 GN=LOC103490196 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 5.8e-13 Identity = 38/42 (90.48%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Bhi05M001693 vs. TrEMBL
Match: tr|A0A0A0K581|A0A0A0K581_CUCSA (Eukaryotic translation initiation factor 3 subunit B OS=Cucumis sativus OX=3659 GN=Csa_7G181640 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 5.8e-13 Identity = 38/42 (90.48%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Bhi05M001693 vs. TrEMBL
Match: tr|A0A1S3CES0|A0A1S3CES0_CUCME (Eukaryotic translation initiation factor 3 subunit B OS=Cucumis melo OX=3656 GN=LOC103500082 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.3e-12 Identity = 37/42 (88.10%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Bhi05M001693 vs. TrEMBL
Match: tr|A0A0A0K4J9|A0A0A0K4J9_CUCSA (Eukaryotic translation initiation factor 3 subunit B OS=Cucumis sativus OX=3659 GN=Csa_7G281370 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.3e-12 Identity = 37/42 (88.10%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Bhi05M001693 vs. NCBI nr
Match: XP_008447809.1 (PREDICTED: eukaryotic translation initiation factor 3 subunit B-like isoform X1 [Cucumis melo] >XP_008447810.1 PREDICTED: eukaryotic translation initiation factor 3 subunit B-like isoform X1 [Cucumis melo]) HSP 1 Score: 81.6 bits (200), Expect = 8.7e-13 Identity = 38/42 (90.48%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Bhi05M001693 vs. NCBI nr
Match: XP_008447811.1 (PREDICTED: eukaryotic translation initiation factor 3 subunit B-like isoform X2 [Cucumis melo]) HSP 1 Score: 81.6 bits (200), Expect = 8.7e-13 Identity = 38/42 (90.48%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Bhi05M001693 vs. NCBI nr
Match: KGN44089.1 (hypothetical protein Csa_7G181640 [Cucumis sativus]) HSP 1 Score: 81.6 bits (200), Expect = 8.7e-13 Identity = 38/42 (90.48%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Bhi05M001693 vs. NCBI nr
Match: XP_004139759.2 (PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation factor 3 subunit B-like [Cucumis sativus]) HSP 1 Score: 81.6 bits (200), Expect = 8.7e-13 Identity = 38/42 (90.48%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Bhi05M001693 vs. NCBI nr
Match: XP_022932539.1 (eukaryotic translation initiation factor 3 subunit B-like [Cucurbita moschata] >XP_022932540.1 eukaryotic translation initiation factor 3 subunit B-like [Cucurbita moschata]) HSP 1 Score: 81.6 bits (200), Expect = 8.7e-13 Identity = 38/42 (90.48%), Postives = 38/42 (90.48%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|