Carg27356 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGGTTGTAGCCTGAAGATTTCAGCCGCTTTTCTGGCTTTGTTTGGCTTCTTCGCTATGGTGGTGAGCGTTCCAAACACGGGAGTCAAGTCAGTTTTGTGCAACTCAGGAATTTTCACGGGGGGCGATCCTTTTGCCGTGAGTCTGGATTACGTTCTAAAAGAATTGGAGAGTTCGACTCCCACTACAAACAATTATGATTTCTACAACATATCTCCTTATCCTAATTCCTTCGCTTACGGCCATGCTTCCTGCAACCAAAGCCTTACAACCTCAGACTGCACCACTTGTCTTGGCGCTGCTAAGACCAACATGTTGGGGTCGTGTCAAATGAGGATTGGTGCTCGTGCGGTGCTCAATGACTGTTCAATTAGGTACGAGCAGAACCCATTTGATGATTAG ATGGTTGGTTGTAGCCTGAAGATTTCAGCCGCTTTTCTGGCTTTGTTTGGCTTCTTCGCTATGGTGGTGAGCGTTCCAAACACGGGAGTCAAGTCAGTTTTGTGCAACTCAGGAATTTTCACGGGGGGCGATCCTTTTGCCGTGAGTCTGGATTACGTTCTAAAAGAATTGGAGAGTTCGACTCCCACTACAAACAATTATGATTTCTACAACATATCTCCTTATCCTAATTCCTTCGCTTACGGCCATGCTTCCTGCAACCAAAGCCTTACAACCTCAGACTGCACCACTTGTCTTGGCGCTGCTAAGACCAACATGTTGGGGTCGTGTCAAATGAGGATTGGTGCTCGTGCGGTGCTCAATGACTGTTCAATTAGGTACGAGCAGAACCCATTTGATGATTAG ATGGTTGGTTGTAGCCTGAAGATTTCAGCCGCTTTTCTGGCTTTGTTTGGCTTCTTCGCTATGGTGGTGAGCGTTCCAAACACGGGAGTCAAGTCAGTTTTGTGCAACTCAGGAATTTTCACGGGGGGCGATCCTTTTGCCGTGAGTCTGGATTACGTTCTAAAAGAATTGGAGAGTTCGACTCCCACTACAAACAATTATGATTTCTACAACATATCTCCTTATCCTAATTCCTTCGCTTACGGCCATGCTTCCTGCAACCAAAGCCTTACAACCTCAGACTGCACCACTTGTCTTGGCGCTGCTAAGACCAACATGTTGGGGTCGTGTCAAATGAGGATTGGTGCTCGTGCGGTGCTCAATGACTGTTCAATTAGGTACGAGCAGAACCCATTTGATGATTAG MVGCSLKISAAFLALFGFFAMVVSVPNTGVKSVLCNSGIFTGGDPFAVSLDYVLKELESSTPTTNNYDFYNISPYPNSFAYGHASCNQSLTTSDCTTCLGAAKTNMLGSCQMRIGARAVLNDCSIRYEQNPFDD
BLAST of Carg27356 vs. NCBI nr
Match: XP_022931011.1 (antifungal protein ginkbilobin-2-like [Cucurbita moschata]) HSP 1 Score: 237.7 bits (605), Expect = 2.4e-59 Identity = 114/114 (100.00%), Postives = 114/114 (100.00%), Query Frame = 0
BLAST of Carg27356 vs. NCBI nr
Match: KGN47889.1 (hypothetical protein Csa_6G409950 [Cucumis sativus]) HSP 1 Score: 229.2 bits (583), Expect = 8.4e-57 Identity = 109/134 (81.34%), Postives = 119/134 (88.81%), Query Frame = 0
BLAST of Carg27356 vs. NCBI nr
Match: XP_008235269.1 (PREDICTED: antifungal protein ginkbilobin-2-like [Prunus mume]) HSP 1 Score: 189.5 bits (480), Expect = 7.4e-45 Identity = 89/131 (67.94%), Postives = 108/131 (82.44%), Query Frame = 0
BLAST of Carg27356 vs. NCBI nr
Match: XP_007199361.2 (antifungal protein ginkbilobin-2 [Prunus persica] >ONH93613.1 hypothetical protein PRUPE_8G242500 [Prunus persica]) HSP 1 Score: 189.5 bits (480), Expect = 7.4e-45 Identity = 89/128 (69.53%), Postives = 107/128 (83.59%), Query Frame = 0
BLAST of Carg27356 vs. NCBI nr
Match: XP_021828640.1 (antifungal protein ginkbilobin-2-like [Prunus avium]) HSP 1 Score: 185.7 bits (470), Expect = 1.1e-43 Identity = 88/131 (67.18%), Postives = 105/131 (80.15%), Query Frame = 0
BLAST of Carg27356 vs. Swiss-Prot
Match: sp|D9IWE0|GNKL_PINPS (Antifungal protein ginkbilobin-like protein OS=Pinus pinaster OX=71647 GN=EAP PE=2 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.9e-12 Identity = 45/110 (40.91%), Postives = 55/110 (50.00%), Query Frame = 0
BLAST of Carg27356 vs. Swiss-Prot
Match: sp|Q3I3X0|GNKL_PICAB (Antifungal protein ginkbilobin-like protein (Fragment) OS=Picea abies OX=3329 GN=EMB24 PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.8e-11 Identity = 41/109 (37.61%), Postives = 55/109 (50.46%), Query Frame = 0
BLAST of Carg27356 vs. Swiss-Prot
Match: sp|A4ZDL6|GNK2_GINBI (Antifungal protein ginkbilobin-2 OS=Ginkgo biloba OX=3311 GN=GNK2 PE=1 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 3.6e-11 Identity = 44/133 (33.08%), Postives = 65/133 (48.87%), Query Frame = 0
BLAST of Carg27356 vs. Swiss-Prot
Match: sp|A9NQT1|GNKL1_PICSI (Antifungal protein ginkbilobin-like protein 1 OS=Picea sitchensis OX=3332 PE=2 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 3.6e-11 Identity = 45/126 (35.71%), Postives = 58/126 (46.03%), Query Frame = 0
BLAST of Carg27356 vs. Swiss-Prot
Match: sp|Q40849|GNKL1_PICGL (Antifungal protein ginkbilobin-like protein 1 OS=Picea glauca OX=3330 GN=EMB24 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 8.1e-11 Identity = 43/129 (33.33%), Postives = 62/129 (48.06%), Query Frame = 0
BLAST of Carg27356 vs. TrEMBL
Match: tr|A0A0A0KGA2|A0A0A0KGA2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G409950 PE=4 SV=1) HSP 1 Score: 229.2 bits (583), Expect = 5.6e-57 Identity = 109/134 (81.34%), Postives = 119/134 (88.81%), Query Frame = 0
BLAST of Carg27356 vs. TrEMBL
Match: tr|A0A251N2S2|A0A251N2S2_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_8G242500 PE=4 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 4.9e-45 Identity = 89/128 (69.53%), Postives = 107/128 (83.59%), Query Frame = 0
BLAST of Carg27356 vs. TrEMBL
Match: tr|M5W194|M5W194_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica OX=3760 GN=PRUPE_ppa025382mg PE=4 SV=1) HSP 1 Score: 185.7 bits (470), Expect = 7.0e-44 Identity = 85/120 (70.83%), Postives = 100/120 (83.33%), Query Frame = 0
BLAST of Carg27356 vs. TrEMBL
Match: tr|A0A067JPK6|A0A067JPK6_JATCU (Uncharacterized protein OS=Jatropha curcas OX=180498 GN=JCGZ_21945 PE=4 SV=1) HSP 1 Score: 182.6 bits (462), Expect = 6.0e-43 Identity = 83/113 (73.45%), Postives = 97/113 (85.84%), Query Frame = 0
BLAST of Carg27356 vs. TrEMBL
Match: tr|A0A2P6PW23|A0A2P6PW23_ROSCH (Putative Gnk2-like domain-containing protein OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr6g0291211 PE=4 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 2.3e-42 Identity = 81/129 (62.79%), Postives = 104/129 (80.62%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|