MELO3C005300.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGGAAGAAAATTCTAGTAGTAGTAATTACATGCGCTCCCTTTTGGATTCAAGGGCGAGCGCTCGTCTTCCTCTTTCTGCTGCTTCTTCTTTCGCTTTTGGTTCTTGCAAGGAAGGCTGGTACTACCGCTGCCTTGGAGTTGACCCTTGA ATGGTGGAAGAAAATTCTAGTAGTAGTAATTACATGCGCTCCCTTTTGGATTCAAGGGCGAGCGCTCGTCTTCCTCTTTCTGCTGCTTCTTCTTTCGCTTTTGGTTCTTGCAAGGAAGGCTGGTACTACCGCTGCCTTGGAGTTGACCCTTGA ATGGTGGAAGAAAATTCTAGTAGTAGTAATTACATGCGCTCCCTTTTGGATTCAAGGGCGAGCGCTCGTCTTCCTCTTTCTGCTGCTTCTTCTTTCGCTTTTGGTTCTTGCAAGGAAGGCTGGTACTACCGCTGCCTTGGAGTTGACCCTTGA MVEENSSSSNYMRSLLDSRASARLPLSAASSFAFGSCKEGWYYRCLGVDP
BLAST of MELO3C005300.2 vs. NCBI nr
Match: XP_008467130.2 (PREDICTED: uncharacterized protein LOC103504558 [Cucumis melo]) HSP 1 Score: 102.8 bits (255), Expect = 3.4e-19 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 0
BLAST of MELO3C005300.2 vs. NCBI nr
Match: XP_016647517.1 (PREDICTED: uncharacterized protein LOC107880498 [Prunus mume] >ONI31761.1 hypothetical protein PRUPE_1G329400 [Prunus persica]) HSP 1 Score: 80.9 bits (198), Expect = 1.4e-12 Identity = 38/44 (86.36%), Postives = 41/44 (93.18%), Query Frame = 0
BLAST of MELO3C005300.2 vs. NCBI nr
Match: XP_017183502.1 (PREDICTED: uncharacterized protein LOC108171629 [Malus domestica]) HSP 1 Score: 79.3 bits (194), Expect = 4.0e-12 Identity = 37/44 (84.09%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C005300.2 vs. NCBI nr
Match: XP_017971818.1 (PREDICTED: uncharacterized protein LOC108660978 [Theobroma cacao]) HSP 1 Score: 79.0 bits (193), Expect = 5.2e-12 Identity = 38/50 (76.00%), Postives = 42/50 (84.00%), Query Frame = 0
BLAST of MELO3C005300.2 vs. NCBI nr
Match: PRQ40962.1 (hypothetical protein RchiOBHm_Chr4g0441831 [Rosa chinensis]) HSP 1 Score: 72.8 bits (177), Expect = 3.8e-10 Identity = 35/45 (77.78%), Postives = 40/45 (88.89%), Query Frame = 0
BLAST of MELO3C005300.2 vs. TAIR10
Match: AT1G70782.1 (conserved peptide upstream open reading frame 28) HSP 1 Score: 64.7 bits (156), Expect = 1.9e-11 Identity = 31/50 (62.00%), Postives = 35/50 (70.00%), Query Frame = 0
BLAST of MELO3C005300.2 vs. TAIR10
Match: AT1G23149.1 (conserved peptide upstream open reading frame 29) HSP 1 Score: 56.6 bits (135), Expect = 5.0e-09 Identity = 28/51 (54.90%), Postives = 35/51 (68.63%), Query Frame = 0
BLAST of MELO3C005300.2 vs. TrEMBL
Match: tr|A0A1S3CSS9|A0A1S3CSS9_CUCME (uncharacterized protein LOC103504558 OS=Cucumis melo OX=3656 GN=LOC103504558 PE=4 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.2e-19 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 0
BLAST of MELO3C005300.2 vs. TrEMBL
Match: tr|A0A251R6V3|A0A251R6V3_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_1G329400 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 9.1e-13 Identity = 38/44 (86.36%), Postives = 41/44 (93.18%), Query Frame = 0
BLAST of MELO3C005300.2 vs. TrEMBL
Match: tr|A0A2P6R3E4|A0A2P6R3E4_ROSCH (Uncharacterized protein OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr4g0441831 PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 2.5e-10 Identity = 35/45 (77.78%), Postives = 40/45 (88.89%), Query Frame = 0
BLAST of MELO3C005300.2 vs. TrEMBL
Match: tr|A0A0D2MCE7|A0A0D2MCE7_GOSRA (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_002G177200 PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 4.2e-10 Identity = 37/50 (74.00%), Postives = 39/50 (78.00%), Query Frame = 0
BLAST of MELO3C005300.2 vs. TrEMBL
Match: tr|A0A1S2YHD7|A0A1S2YHD7_CICAR (uncharacterized protein LOC101507525 OS=Cicer arietinum OX=3827 GN=LOC101507525 PE=4 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.7e-09 Identity = 34/48 (70.83%), Postives = 39/48 (81.25%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|