MELO3C028601.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GCTTTGGCAAATGCATGGAAGGATGCATGTGGATCGACCAATCCAAGTAAATTGTTGATTCCAATAGGAGTTTACCAACTAAACCAATCCATTCTCCATGGTCCTTGCAAAAGTACTATTGAGGTTCAGATGGAAGGAACATTACAAGCTCATCCCGATCCAATAGGAGATGG GCTTTGGCAAATGCATGGAAGGATGCATGTGGATCGACCAATCCAAGTAAATTGTTGATTCCAATAGGAGTTTACCAACTAAACCAATCCATTCTCCATGGTCCTTGCAAAAGTACTATTGAGGTTCAGATGGAAGGAACATTACAAGCTCATCCCGATCCAATAGGAGATGG GCTTTGGCAAATGCATGGAAGGATGCATGTGGATCGACCAATCCAAGTAAATTGTTGATTCCAATAGGAGTTTACCAACTAAACCAATCCATTCTCCATGGTCCTTGCAAAAGTACTATTGAGGTTCAGATGGAAGGAACATTACAAGCTCATCCCGATCCAATAGGAGAT ALANAWKDACGSTNPSKLLIPIGVYQLNQSILHGPCKSTIEVQMEGTLQAHPDPIGD
BLAST of MELO3C028601.2.1 vs. NCBI nr
Match: XP_011658677.1 (PREDICTED: exopolygalacturonase-like [Cucumis sativus]) HSP 1 Score: 109.8 bits (273), Expect = 3.2e-21 Identity = 50/57 (87.72%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. NCBI nr
Match: XP_008455507.2 (PREDICTED: exopolygalacturonase-like [Cucumis melo]) HSP 1 Score: 106.7 bits (265), Expect = 2.7e-20 Identity = 48/55 (87.27%), Postives = 51/55 (92.73%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. NCBI nr
Match: XP_011658673.1 (PREDICTED: exopolygalacturonase-like [Cucumis sativus]) HSP 1 Score: 102.8 bits (255), Expect = 3.9e-19 Identity = 47/57 (82.46%), Postives = 52/57 (91.23%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. NCBI nr
Match: XP_004140444.1 (PREDICTED: exopolygalacturonase-like [Cucumis sativus]) HSP 1 Score: 85.9 bits (211), Expect = 4.9e-14 Identity = 39/57 (68.42%), Postives = 47/57 (82.46%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. NCBI nr
Match: XP_016903689.1 (PREDICTED: exopolygalacturonase-like, partial [Cucumis melo]) HSP 1 Score: 85.1 bits (209), Expect = 8.3e-14 Identity = 40/57 (70.18%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. TAIR10
Match: AT3G07820.1 (Pectin lyase-like superfamily protein) HSP 1 Score: 55.1 bits (131), Expect = 1.7e-08 Identity = 24/55 (43.64%), Postives = 39/55 (70.91%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. TAIR10
Match: AT1G17150.1 (Pectin lyase-like superfamily protein) HSP 1 Score: 54.7 bits (130), Expect = 2.2e-08 Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. TAIR10
Match: AT3G07830.1 (Pectin lyase-like superfamily protein) HSP 1 Score: 50.1 bits (118), Expect = 5.4e-07 Identity = 22/55 (40.00%), Postives = 35/55 (63.64%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. TAIR10
Match: AT1G78400.1 (Pectin lyase-like superfamily protein) HSP 1 Score: 49.3 bits (116), Expect = 9.2e-07 Identity = 23/54 (42.59%), Postives = 28/54 (51.85%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. TAIR10
Match: AT1G05650.1 (Pectin lyase-like superfamily protein) HSP 1 Score: 47.8 bits (112), Expect = 2.7e-06 Identity = 21/53 (39.62%), Postives = 29/53 (54.72%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. Swiss-Prot
Match: sp|Q40312|PGLR_MEDSA (Polygalacturonase OS=Medicago sativa OX=3879 PE=2 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 5.3e-12 Identity = 30/54 (55.56%), Postives = 40/54 (74.07%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. Swiss-Prot
Match: sp|Q05967|PGLR_TOBAC (Polygalacturonase OS=Nicotiana tabacum OX=4097 GN=PG1 PE=2 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 7.7e-11 Identity = 29/54 (53.70%), Postives = 41/54 (75.93%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. Swiss-Prot
Match: sp|Q39766|PGLR_GOSBA (Polygalacturonase OS=Gossypium barbadense OX=3634 GN=G9 PE=2 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 5.0e-10 Identity = 26/51 (50.98%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. Swiss-Prot
Match: sp|Q39786|PGLR_GOSHI (Polygalacturonase OS=Gossypium hirsutum OX=3635 GN=G9 PE=2 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 5.0e-10 Identity = 26/51 (50.98%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. Swiss-Prot
Match: sp|P24548|PGLR_OENOR (Exopolygalacturonase (Fragment) OS=Oenothera organensis OX=3945 PE=2 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 5.0e-10 Identity = 27/54 (50.00%), Postives = 38/54 (70.37%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. TrEMBL
Match: tr|A0A1S3C129|A0A1S3C129_CUCME (exopolygalacturonase-like OS=Cucumis melo OX=3656 GN=LOC103495658 PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.8e-20 Identity = 48/55 (87.27%), Postives = 51/55 (92.73%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. TrEMBL
Match: tr|A0A1S4E643|A0A1S4E643_CUCME (exopolygalacturonase-like OS=Cucumis melo OX=3656 GN=LOC103504477 PE=3 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 5.5e-14 Identity = 40/57 (70.18%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. TrEMBL
Match: tr|A0A1S3BN96|A0A1S3BN96_CUCME (exopolygalacturonase-like OS=Cucumis melo OX=3656 GN=LOC103491498 PE=3 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 4.7e-13 Identity = 38/57 (66.67%), Postives = 45/57 (78.95%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. TrEMBL
Match: tr|A0A1S3BML3|A0A1S3BML3_CUCME (LOW QUALITY PROTEIN: exopolygalacturonase-like OS=Cucumis melo OX=3656 GN=LOC103491497 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 6.1e-13 Identity = 38/57 (66.67%), Postives = 45/57 (78.95%), Query Frame = 0
BLAST of MELO3C028601.2.1 vs. TrEMBL
Match: tr|A0A1S3B3X5|A0A1S3B3X5_CUCME (exopolygalacturonase-like OS=Cucumis melo OX=3656 GN=LOC103485719 PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.8e-12 Identity = 37/57 (64.91%), Postives = 44/57 (77.19%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|