CsGy3G020840.1 (mRNA) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTTCTTCAAGATTGGAATCTATGTTTAGTGTATGGTTGATTAGAATGAAGCATATATATTTTATTCTAAAGTTAAAATGAAGCACTAAGCTTCTGATCCGGAAGCTTCCGTTTCAACGTTTAGTTCGTGAAATTGCTCAGAATTTCAAAACCGACCTGAGGTTCCAGAGCAGTGTCGTCGCGACGCTTCAGGAAGCGGTCGAAGCCTATTTGGTTGGTTTGTTTGAGGATACGAATCTTTGTGCTATTTATGCTAAGAGGATAACCATTATGCCTGAGGATATTCAATTGGCAAGGAGGATTAGAGGGGAAAGGGCTTAG ATGGTTTCTTCAAGATTGGAATCTATCACTAAGCTTCTGATCCGGAAGCTTCCGTTTCAACGTTTAGTTCGTGAAATTGCTCAGAATTTCAAAACCGACCTGAGGTTCCAGAGCAGTGTCGTCGCGACGCTTCAGGAAGCGGTCGAAGCCTATTTGGTTGGTTTGTTTGAGGATACGAATCTTTGTGCTATTTATGCTAAGAGGATAACCATTATGCCTGAGGATATTCAATTGGCAAGGAGGATTAGAGGGGAAAGGGCTTAG ATGGTTTCTTCAAGATTGGAATCTATCACTAAGCTTCTGATCCGGAAGCTTCCGTTTCAACGTTTAGTTCGTGAAATTGCTCAGAATTTCAAAACCGACCTGAGGTTCCAGAGCAGTGTCGTCGCGACGCTTCAGGAAGCGGTCGAAGCCTATTTGGTTGGTTTGTTTGAGGATACGAATCTTTGTGCTATTTATGCTAAGAGGATAACCATTATGCCTGAGGATATTCAATTGGCAAGGAGGATTAGAGGGGAAAGGGCTTAG MVSSRLESITKLLIRKLPFQRLVREIAQNFKTDLRFQSSVVATLQEAVEAYLVGLFEDTNLCAIYAKRITIMPEDIQLARRIRGERA
BLAST of CsGy3G020840.1 vs. NCBI nr
Match: KGN65378.1 (hypothetical protein Csa_1G392600 [Cucumis sativus]) HSP 1 Score: 156.4 bits (394), Expect = 4.5e-35 Identity = 85/91 (93.41%), Postives = 87/91 (95.60%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. NCBI nr
Match: P08903.2 (RecName: Full=Histone H3.2) HSP 1 Score: 138.3 bits (347), Expect = 1.3e-29 Identity = 71/83 (85.54%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. NCBI nr
Match: prf||1202289A (histone H3) HSP 1 Score: 138.3 bits (347), Expect = 1.3e-29 Identity = 71/83 (85.54%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. NCBI nr
Match: XP_006442699.1 (histone H3.2 [Citrus clementina] >ESR55939.1 hypothetical protein CICLE_v10024580mg [Citrus clementina]) HSP 1 Score: 137.9 bits (346), Expect = 1.7e-29 Identity = 70/78 (89.74%), Postives = 75/78 (96.15%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. NCBI nr
Match: XP_003384122.1 (PREDICTED: histone H3-like [Amphimedon queenslandica] >XP_003384138.1 PREDICTED: histone H3-like [Amphimedon queenslandica]) HSP 1 Score: 137.5 bits (345), Expect = 2.2e-29 Identity = 71/83 (85.54%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. TAIR10
Match: AT1G09200.1 (Histone superfamily protein) HSP 1 Score: 137.1 bits (344), Expect = 5.1e-33 Identity = 70/83 (84.34%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. TAIR10
Match: AT3G27360.1 (Histone superfamily protein) HSP 1 Score: 137.1 bits (344), Expect = 5.1e-33 Identity = 70/83 (84.34%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. TAIR10
Match: AT5G10390.1 (Histone superfamily protein) HSP 1 Score: 137.1 bits (344), Expect = 5.1e-33 Identity = 70/83 (84.34%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. TAIR10
Match: AT5G10400.1 (Histone superfamily protein) HSP 1 Score: 137.1 bits (344), Expect = 5.1e-33 Identity = 70/83 (84.34%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. TAIR10
Match: AT5G65360.1 (Histone superfamily protein) HSP 1 Score: 137.1 bits (344), Expect = 5.1e-33 Identity = 70/83 (84.34%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. Swiss-Prot
Match: sp|P08903|H32_ENCAL (Histone H3.2 OS=Encephalartos altensteinii OX=3300 PE=1 SV=2) HSP 1 Score: 138.3 bits (347), Expect = 4.1e-32 Identity = 71/83 (85.54%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. Swiss-Prot
Match: sp|P59226|H32_ARATH (Histone H3.2 OS=Arabidopsis thaliana OX=3702 GN=HTR2 PE=1 SV=2) HSP 1 Score: 137.1 bits (344), Expect = 9.2e-32 Identity = 70/83 (84.34%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. Swiss-Prot
Match: sp|Q6LBE3|H32_ASPOF (Histone H3.2 OS=Asparagus officinalis OX=4686 PE=2 SV=3) HSP 1 Score: 137.1 bits (344), Expect = 9.2e-32 Identity = 70/83 (84.34%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. Swiss-Prot
Match: sp|Q6LCK1|H32_BRANA (Histone H3.2 OS=Brassica napus OX=3708 PE=2 SV=3) HSP 1 Score: 137.1 bits (344), Expect = 9.2e-32 Identity = 70/83 (84.34%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. Swiss-Prot
Match: sp|Q71T45|H32_EUPES (Histone H3.2 OS=Euphorbia esula OX=3993 GN=H3 PE=2 SV=3) HSP 1 Score: 137.1 bits (344), Expect = 9.2e-32 Identity = 70/83 (84.34%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. TrEMBL
Match: tr|A0A0A0LUA6|A0A0A0LUA6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G392600 PE=3 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 3.0e-35 Identity = 85/91 (93.41%), Postives = 87/91 (95.60%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. TrEMBL
Match: tr|V4VS74|V4VS74_9ROSI (Histone H3 OS=Citrus clementina OX=85681 GN=CICLE_v10024580mg PE=3 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 1.1e-29 Identity = 70/78 (89.74%), Postives = 75/78 (96.15%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. TrEMBL
Match: tr|I1G9C5|I1G9C5_AMPQE (Histone H3 OS=Amphimedon queenslandica OX=400682 PE=3 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 1.4e-29 Identity = 71/83 (85.54%), Postives = 77/83 (92.77%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. TrEMBL
Match: tr|U7E2D0|U7E2D0_POPTR (Uncharacterized protein (Fragment) OS=Populus trichocarpa OX=3694 GN=POPTR_0108s00230g PE=3 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 1.4e-29 Identity = 70/78 (89.74%), Postives = 75/78 (96.15%), Query Frame = 0
BLAST of CsGy3G020840.1 vs. TrEMBL
Match: tr|A0A2K2BAD3|A0A2K2BAD3_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_003G208800v3 PE=3 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 1.4e-29 Identity = 70/78 (89.74%), Postives = 75/78 (96.15%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
|