Cp4.1LG11g07160.1 (mRNA) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGATTGCAAGACTTGCCGTAGTGAGCTTCTTGCTGGTGATTTCGTTTTTGTCTATTGGGGATTGCAATTTGGTGTTCAATGTTCATCACAAGTTCAAGGGCCGCGAGAGGTCCTTGGAAGCCTTCAAAGCCCACGATGTTCTCCGTCGCGGTAGATTTCTTTCTGCTATTGATCTCAACTTGGGCGGCAACGGACACCCTTCTGAATCTGGGTTAGTCTTGATTTCTGTTGTGGTTATTTAG ATGGAGATTGCAAGACTTGCCGTAGTGAGCTTCTTGCTGGTGATTTCGTTTTTGTCTATTGGGGATTGCAATTTGGTGTTCAATGTTCATCACAAGTTCAAGGGCCGCGAGAGGTCCTTGGAAGCCTTCAAAGCCCACGATGTTCTCCGTCGCGGTAGATTTCTTTCTGCTATTGATCTCAACTTGGGCGGCAACGGACACCCTTCTGAATCTGGGTTAGTCTTGATTTCTGTTGTGGTTATTTAG ATGGAGATTGCAAGACTTGCCGTAGTGAGCTTCTTGCTGGTGATTTCGTTTTTGTCTATTGGGGATTGCAATTTGGTGTTCAATGTTCATCACAAGTTCAAGGGCCGCGAGAGGTCCTTGGAAGCCTTCAAAGCCCACGATGTTCTCCGTCGCGGTAGATTTCTTTCTGCTATTGATCTCAACTTGGGCGGCAACGGACACCCTTCTGAATCTGGGTTAGTCTTGATTTCTGTTGTGGTTATTTAG MEIARLAVVSFLLVISFLSIGDCNLVFNVHHKFKGRERSLEAFKAHDVLRRGRFLSAIDLNLGGNGHPSESGLVLISVVVI
BLAST of Cp4.1LG11g07160.1 vs. Swiss-Prot
Match: ASPL2_ARATH (Aspartic proteinase-like protein 2 OS=Arabidopsis thaliana GN=At1g65240 PE=1 SV=2) HSP 1 Score: 58.9 bits (141), Expect = 2.9e-08 Identity = 33/81 (40.74%), Postives = 46/81 (56.79%), Query Frame = 1
BLAST of Cp4.1LG11g07160.1 vs. TrEMBL
Match: A0A0A0LJW2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G099480 PE=3 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.2e-26 Identity = 63/78 (80.77%), Postives = 65/78 (83.33%), Query Frame = 1
BLAST of Cp4.1LG11g07160.1 vs. TrEMBL
Match: A0A0A0M011_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G651140 PE=3 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.7e-16 Identity = 47/73 (64.38%), Postives = 55/73 (75.34%), Query Frame = 1
BLAST of Cp4.1LG11g07160.1 vs. TrEMBL
Match: B9RM62_RICCO (Aspartic proteinase Asp1, putative OS=Ricinus communis GN=RCOM_1077820 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.0e-12 Identity = 44/82 (53.66%), Postives = 52/82 (63.41%), Query Frame = 1
BLAST of Cp4.1LG11g07160.1 vs. TrEMBL
Match: D7SPN2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_04s0023g00730 PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.4e-12 Identity = 40/78 (51.28%), Postives = 51/78 (65.38%), Query Frame = 1
BLAST of Cp4.1LG11g07160.1 vs. TrEMBL
Match: A5B3D1_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_020864 PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.4e-12 Identity = 40/78 (51.28%), Postives = 51/78 (65.38%), Query Frame = 1
BLAST of Cp4.1LG11g07160.1 vs. TAIR10
Match: AT5G36260.1 (AT5G36260.1 Eukaryotic aspartyl protease family protein) HSP 1 Score: 59.3 bits (142), Expect = 1.3e-09 Identity = 33/76 (43.42%), Postives = 43/76 (56.58%), Query Frame = 1
BLAST of Cp4.1LG11g07160.1 vs. TAIR10
Match: AT1G65240.1 (AT1G65240.1 Eukaryotic aspartyl protease family protein) HSP 1 Score: 58.9 bits (141), Expect = 1.6e-09 Identity = 33/81 (40.74%), Postives = 46/81 (56.79%), Query Frame = 1
BLAST of Cp4.1LG11g07160.1 vs. TAIR10
Match: AT3G02740.1 (AT3G02740.1 Eukaryotic aspartyl protease family protein) HSP 1 Score: 52.4 bits (124), Expect = 1.5e-07 Identity = 28/56 (50.00%), Postives = 33/56 (58.93%), Query Frame = 1
BLAST of Cp4.1LG11g07160.1 vs. NCBI nr
Match: gi|449442281|ref|XP_004138910.1| (PREDICTED: aspartic proteinase-like protein 2 [Cucumis sativus]) HSP 1 Score: 125.9 bits (315), Expect = 3.1e-26 Identity = 63/78 (80.77%), Postives = 65/78 (83.33%), Query Frame = 1
BLAST of Cp4.1LG11g07160.1 vs. NCBI nr
Match: gi|659082210|ref|XP_008441721.1| (PREDICTED: aspartic proteinase-like protein 2 [Cucumis melo]) HSP 1 Score: 114.8 bits (286), Expect = 7.2e-23 Identity = 60/78 (76.92%), Postives = 63/78 (80.77%), Query Frame = 1
BLAST of Cp4.1LG11g07160.1 vs. NCBI nr
Match: gi|449442641|ref|XP_004139089.1| (PREDICTED: aspartic proteinase-like protein 2 [Cucumis sativus]) HSP 1 Score: 92.4 bits (228), Expect = 3.8e-16 Identity = 47/73 (64.38%), Postives = 55/73 (75.34%), Query Frame = 1
BLAST of Cp4.1LG11g07160.1 vs. NCBI nr
Match: gi|659085859|ref|XP_008443647.1| (PREDICTED: aspartic proteinase-like protein 2 [Cucumis melo]) HSP 1 Score: 92.0 bits (227), Expect = 5.0e-16 Identity = 47/73 (64.38%), Postives = 54/73 (73.97%), Query Frame = 1
BLAST of Cp4.1LG11g07160.1 vs. NCBI nr
Match: gi|255547548|ref|XP_002514831.1| (PREDICTED: aspartic proteinase-like protein 2 [Ricinus communis]) HSP 1 Score: 80.5 bits (197), Expect = 1.5e-12 Identity = 44/82 (53.66%), Postives = 52/82 (63.41%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
|