Cucsa.205380.1 (mRNA) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACCGGATGGGTATGAAGATGCAGTAGAGGCACCCCTCAGTGGCTGTAAGGTTTAATGAGCAAATTGGAAGTAGAAAAGGGTCCACATTCATTCAACCCAAGAGGGCTTGGCTTCCTAAGTTTCTCTTGCTCTGGGTTCTGTTGGTGGCATTCATCAGTTTGTTAATCTACAAGGGAATGAACACTGATAACAAAGTTAGAAGAAAGGAAGTTCTGGGAAGTATGTGTAACCAGAGGGAGGGCAAGG ATGACCGGATGGCAAATTGGAAGTAGAAAAGGGTCCACATTCATTCAACCCAAGAGGGCTTGGCTTCCTAAGTTTCTCTTGCTCTGGGTTCTGTTGGTGGCATTCATCAGTTTGTTAATCTACAAGGGAATGAACACTGATAACAAAGTTAGAAGAAAGGAAGTTCTGGGAAGTATGTGTAACCAGAGGGAGGGCAAGG ATGACCGGATGGCAAATTGGAAGTAGAAAAGGGTCCACATTCATTCAACCCAAGAGGGCTTGGCTTCCTAAGTTTCTCTTGCTCTGGGTTCTGTTGGTGGCATTCATCAGTTTGTTAATCTACAAGGGAATGAACACTGATAACAAAGTTAGAAGAAAGGAAGTTCTGGGAAGTATGTGTAACCAGAGGGAGGGCAAGG MTGWQIGSRKGSTFIQPKRAWLPKFLLLWVLLVAFISLLIYKGMNTDNKVRRKEVLGSMCNQREGKX
BLAST of Cucsa.205380.1 vs. Swiss-Prot
Match: AHK4_ARATH (Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 5.6e-13 Identity = 35/58 (60.34%), Postives = 47/58 (81.03%), Query Frame = 1
BLAST of Cucsa.205380.1 vs. TrEMBL
Match: B8QJH0_BETPN (Cytokinin receptor 1 (Fragment) OS=Betula pendula GN=CRE1 PE=2 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.9e-16 Identity = 39/59 (66.10%), Postives = 51/59 (86.44%), Query Frame = 1
BLAST of Cucsa.205380.1 vs. TrEMBL
Match: A0A061E9K7_THECC (CHASE domain containing histidine kinase protein isoform 1 OS=Theobroma cacao GN=TCM_011246 PE=4 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 6.4e-16 Identity = 41/59 (69.49%), Postives = 51/59 (86.44%), Query Frame = 1
BLAST of Cucsa.205380.1 vs. TrEMBL
Match: A0A061EG96_THECC (CHASE domain containing histidine kinase protein isoform 2 OS=Theobroma cacao GN=TCM_011246 PE=4 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 6.4e-16 Identity = 41/59 (69.49%), Postives = 51/59 (86.44%), Query Frame = 1
BLAST of Cucsa.205380.1 vs. TrEMBL
Match: A0A0B0NL07_GOSAR (Histidine kinase 4-like protein OS=Gossypium arboreum GN=F383_20398 PE=4 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 6.4e-16 Identity = 41/59 (69.49%), Postives = 51/59 (86.44%), Query Frame = 1
BLAST of Cucsa.205380.1 vs. TrEMBL
Match: A0A0D2S7K4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G031500 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.4e-15 Identity = 40/59 (67.80%), Postives = 51/59 (86.44%), Query Frame = 1
BLAST of Cucsa.205380.1 vs. TAIR10
Match: AT2G01830.2 (AT2G01830.2 CHASE domain containing histidine kinase protein) HSP 1 Score: 74.3 bits (181), Expect = 3.1e-14 Identity = 35/58 (60.34%), Postives = 47/58 (81.03%), Query Frame = 1
BLAST of Cucsa.205380.1 vs. NCBI nr
Match: gi|659114017|ref|XP_008456868.1| (PREDICTED: histidine kinase 4-like [Cucumis melo]) HSP 1 Score: 111.3 bits (277), Expect = 6.6e-22 Identity = 53/59 (89.83%), Postives = 57/59 (96.61%), Query Frame = 1
BLAST of Cucsa.205380.1 vs. NCBI nr
Match: gi|449445312|ref|XP_004140417.1| (PREDICTED: histidine kinase 4 [Cucumis sativus]) HSP 1 Score: 109.0 bits (271), Expect = 3.3e-21 Identity = 52/59 (88.14%), Postives = 56/59 (94.92%), Query Frame = 1
BLAST of Cucsa.205380.1 vs. NCBI nr
Match: gi|802596824|ref|XP_012072360.1| (PREDICTED: histidine kinase 4 isoform X1 [Jatropha curcas]) HSP 1 Score: 94.7 bits (234), Expect = 6.4e-17 Identity = 42/59 (71.19%), Postives = 53/59 (89.83%), Query Frame = 1
BLAST of Cucsa.205380.1 vs. NCBI nr
Match: gi|802596826|ref|XP_012072361.1| (PREDICTED: histidine kinase 4 isoform X2 [Jatropha curcas]) HSP 1 Score: 94.7 bits (234), Expect = 6.4e-17 Identity = 42/59 (71.19%), Postives = 53/59 (89.83%), Query Frame = 1
BLAST of Cucsa.205380.1 vs. NCBI nr
Match: gi|190148353|gb|ACE63259.1| (cytokinin receptor 1 [Betula pendula]) HSP 1 Score: 91.3 bits (225), Expect = 7.0e-16 Identity = 39/59 (66.10%), Postives = 51/59 (86.44%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
|