Cucsa.079930.1 (mRNA) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ACTATCACCGTCCTTGTCGTTGCTATTGTCACTCTCTCTCCCATCCTCGACAAACATCCTCTCTTCGTTATCAAAAATTTCCTCAGTCTCCATATCGTCTTGGACTACTACGATCCCACAAAACTCCACAAGATCTCCAACGGTTGTTTTTTCCATACACTTCGTTTTTCCCTTTTGGCCCTCTTCCTCTCTCATTCACGACCTTTCTTTCTTCATCATTCTCCACCTTCGATATTCCTCCAATCTGAATCTCTCTTCACTTTTCATATCTTCTTTCAATTCATCCCTTCTCTTTTCTTATCACTTATGTAATCTCTTCAATCTCTTTTCATATTTTACGGATTTTTGTGACGGGATATCGGTTTTACCATTCTTCTAATTGTTATTTCTTCATCTTTTCCTGATTTCTTGTTCTCTTTTGGTGTCTTTGTTTTTTGTTACACTGCTTGATTTGATTACTTTTGTGGGTTTCTTTTTGTTTCATCTCAGGTCATTCTTACACAAACTGAAATAGCCGGTTAAGGGAAAGGAGAAATGGGATTGACCTTCACCAAGCTTTTCAGTAGGCTTTTTGCCAAGAAGGAGATGCAAATTTTTATGGTTGGTCTTGATGCTGCTAGAAAGACCACGATCTCGTACAAGCTCTAG ACTATCACCGTCCTTGTCGTTGCTATTGTCACTCTCTCTCCCATCCTCGACAAACATCCTCTCTTCGTTATCAAAAATTTCCTCAGTCTCCATATCGTCTTGGACTACTACGATCCCACAAAACTCCACAAGATCTCCAACGGGAAAGGAGAAATGGGATTGACCTTCACCAAGCTTTTCAGTAGGCTTTTTGCCAAGAAGGAGATGCAAATTTTTATGGTTGGTCTTGATGCTGCTAGAAAGACCACGATCTCGTACAAGCTCTAG ACTATCACCGTCCTTGTCGTTGCTATTGTCACTCTCTCTCCCATCCTCGACAAACATCCTCTCTTCGTTATCAAAAATTTCCTCAGTCTCCATATCGTCTTGGACTACTACGATCCCACAAAACTCCACAAGATCTCCAACGGGAAAGGAGAAATGGGATTGACCTTCACCAAGCTTTTCAGTAGGCTTTTTGCCAAGAAGGAGATGCAAATTTTTATGGTTGGTCTTGATGCTGCTAGAAAGACCACGATCTCGTACAAGCTCTAG TITVLVVAIVTLSPILDKHPLFVIKNFLSLHIVLDYYDPTKLHKISNGKGEMGLTFTKLFSRLFAKKEMQIFMVGLDAARKTTISYKL*
BLAST of Cucsa.079930.1 vs. Swiss-Prot
Match: ARF1_ORYSJ (ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica GN=Os01g0813400 PE=2 SV=3) HSP 1 Score: 65.5 bits (158), Expect = 3.4e-10 Identity = 33/37 (89.19%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. Swiss-Prot
Match: ARF_MAIZE (ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 SV=2) HSP 1 Score: 65.5 bits (158), Expect = 3.4e-10 Identity = 33/37 (89.19%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. Swiss-Prot
Match: ARF2_ORYSJ (ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica GN=ARF PE=2 SV=2) HSP 1 Score: 65.5 bits (158), Expect = 3.4e-10 Identity = 33/37 (89.19%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. Swiss-Prot
Match: ARF_VIGUN (ADP-ribosylation factor OS=Vigna unguiculata GN=ARF PE=2 SV=3) HSP 1 Score: 63.9 bits (154), Expect = 1.0e-09 Identity = 32/37 (86.49%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. Swiss-Prot
Match: ARF1_DAUCA (ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1 PE=2 SV=2) HSP 1 Score: 63.9 bits (154), Expect = 1.0e-09 Identity = 32/37 (86.49%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. TrEMBL
Match: A0A0A0KCV6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G076800 PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.4e-13 Identity = 42/48 (87.50%), Postives = 42/48 (87.50%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. TrEMBL
Match: J3L559_ORYBR (Uncharacterized protein OS=Oryza brachyantha PE=3 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 9.1e-10 Identity = 36/45 (80.00%), Postives = 39/45 (86.67%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. TrEMBL
Match: A0A0E0JQ56_ORYPU (Uncharacterized protein OS=Oryza punctata PE=3 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 9.1e-10 Identity = 36/43 (83.72%), Postives = 37/43 (86.05%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. TrEMBL
Match: A0A0E0C9E1_9ORYZ (Uncharacterized protein OS=Oryza meridionalis PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.2e-09 Identity = 37/50 (74.00%), Postives = 40/50 (80.00%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. TrEMBL
Match: A0A0D3EVD4_9ORYZ (Uncharacterized protein OS=Oryza barthii PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.0e-09 Identity = 35/39 (89.74%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. TAIR10
Match: AT5G14670.1 (AT5G14670.1 ADP-ribosylation factor A1B) HSP 1 Score: 63.5 bits (153), Expect = 7.4e-11 Identity = 32/37 (86.49%), Postives = 33/37 (89.19%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. TAIR10
Match: AT1G23490.1 (AT1G23490.1 ADP-ribosylation factor 1) HSP 1 Score: 62.0 bits (149), Expect = 2.1e-10 Identity = 31/37 (83.78%), Postives = 33/37 (89.19%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. TAIR10
Match: AT1G10630.1 (AT1G10630.1 ADP-ribosylation factor A1F) HSP 1 Score: 62.0 bits (149), Expect = 2.1e-10 Identity = 31/37 (83.78%), Postives = 33/37 (89.19%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. TAIR10
Match: AT1G70490.1 (AT1G70490.1 Ras-related small GTP-binding family protein) HSP 1 Score: 62.0 bits (149), Expect = 2.1e-10 Identity = 31/37 (83.78%), Postives = 33/37 (89.19%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. TAIR10
Match: AT2G47170.1 (AT2G47170.1 Ras-related small GTP-binding family protein) HSP 1 Score: 61.2 bits (147), Expect = 3.6e-10 Identity = 31/37 (83.78%), Postives = 33/37 (89.19%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. NCBI nr
Match: gi|449473469|ref|XP_004153890.1| (PREDICTED: fasciclin-like arabinogalactan protein 10 [Cucumis sativus]) HSP 1 Score: 83.6 bits (205), Expect = 1.9e-13 Identity = 42/48 (87.50%), Postives = 42/48 (87.50%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. NCBI nr
Match: gi|659120321|ref|XP_008460132.1| (PREDICTED: fasciclin-like arabinogalactan protein 10 [Cucumis melo]) HSP 1 Score: 82.4 bits (202), Expect = 4.3e-13 Identity = 41/48 (85.42%), Postives = 42/48 (87.50%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. NCBI nr
Match: gi|20161472|dbj|BAB90396.1| (ADP-ribosylation factor [Oryza sativa Japonica Group]) HSP 1 Score: 71.6 bits (174), Expect = 7.7e-10 Identity = 36/41 (87.80%), Postives = 37/41 (90.24%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. NCBI nr
Match: gi|960468742|ref|XP_010232477.2| (PREDICTED: ADP-ribosylation factor 2 [Brachypodium distachyon]) HSP 1 Score: 69.7 bits (169), Expect = 2.9e-09 Identity = 35/39 (89.74%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of Cucsa.079930.1 vs. NCBI nr
Match: gi|475592749|gb|EMT22177.1| (ADP-ribosylation factor [Aegilops tauschii]) HSP 1 Score: 68.6 bits (166), Expect = 6.5e-09 Identity = 35/41 (85.37%), Postives = 36/41 (87.80%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
|