Cucsa.255320 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACGAGAGTGGTGGTCGTGGAAGAGGTTATGGGGACGACTCCACAGGCAGCAGAGAGATTCGTTACCGGGGAGTACGACGTCGGCCATGGGGAAAATTCGCTGCTGAAATACGAGACTCTAGAAGGCAAGGAGTACGGATATGGCTAGGGACTTTCAACACTGCAGAAGAAGCAGCACGAGCTTACGATCGAGCGGCCTACAACATGAGGGGTCATTTGGCCATTTTGAATTTTCCTAATGAATATCCGCTTACCAGGGGTGGGGCTTATTCGAGTGGGTCATCTTCTTCTTCTTCAATGTCAATGCGGCAAAATGAAGTGATTGAATTTGAGTATTTGGATGATAAAGTGCTGGAAGATCTTCTTGACTATGGAGAAGAAAGTGATAAGAGAAGCTAA ATGGACGAGAGTGGTGGTCGTGGAAGAGGTTATGGGGACGACTCCACAGGCAGCAGAGAGATTCGTTACCGGGGAGTACGACGTCGGCCATGGGGAAAATTCGCTGCTGAAATACGAGACTCTAGAAGGCAAGGAGTACGGATATGGCTAGGGACTTTCAACACTGCAGAAGAAGCAGCACGAGCTTACGATCGAGCGGCCTACAACATGAGGGGTCATTTGGCCATTTTGAATTTTCCTAATGAATATCCGCTTACCAGGGGTGGGGCTTATTCGAGTGGGTCATCTTCTTCTTCTTCAATGTCAATGCGGCAAAATGAAGTGATTGAATTTGAGTATTTGGATGATAAAGTGCTGGAAGATCTTCTTGACTATGGAGAAGAAAGTGATAAGAGAAGCTAA ATGGACGAGAGTGGTGGTCGTGGAAGAGGTTATGGGGACGACTCCACAGGCAGCAGAGAGATTCGTTACCGGGGAGTACGACGTCGGCCATGGGGAAAATTCGCTGCTGAAATACGAGACTCTAGAAGGCAAGGAGTACGGATATGGCTAGGGACTTTCAACACTGCAGAAGAAGCAGCACGAGCTTACGATCGAGCGGCCTACAACATGAGGGGTCATTTGGCCATTTTGAATTTTCCTAATGAATATCCGCTTACCAGGGGTGGGGCTTATTCGAGTGGGTCATCTTCTTCTTCTTCAATGTCAATGCGGCAAAATGAAGTGATTGAATTTGAGTATTTGGATGATAAAGTGCTGGAAGATCTTCTTGACTATGGAGAAGAAAGTGATAAGAGAAGCTAA MDESGGRGRGYGDDSTGSREIRYRGVRRRPWGKFAAEIRDSRRQGVRIWLGTFNTAEEAARAYDRAAYNMRGHLAILNFPNEYPLTRGGAYSSGSSSSSSMSMRQNEVIEFEYLDDKVLEDLLDYGEESDKRS*
BLAST of Cucsa.255320 vs. Swiss-Prot
Match: ERF97_ARATH (Ethylene-responsive transcription factor 14 OS=Arabidopsis thaliana GN=ERF14 PE=2 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 1.3e-37 Identity = 78/129 (60.47%), Postives = 99/129 (76.74%), Query Frame = 1
BLAST of Cucsa.255320 vs. Swiss-Prot
Match: ERF98_ARATH (Ethylene-responsive transcription factor ERF098 OS=Arabidopsis thaliana GN=ERF098 PE=1 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 1.9e-36 Identity = 82/131 (62.60%), Postives = 92/131 (70.23%), Query Frame = 1
BLAST of Cucsa.255320 vs. Swiss-Prot
Match: ERF96_ARATH (Ethylene-responsive transcription factor ERF096 OS=Arabidopsis thaliana GN=ERF096 PE=2 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 3.2e-36 Identity = 78/133 (58.65%), Postives = 97/133 (72.93%), Query Frame = 1
BLAST of Cucsa.255320 vs. Swiss-Prot
Match: ERF95_ARATH (Ethylene-responsive transcription factor ERF095 OS=Arabidopsis thaliana GN=ERF095 PE=1 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 1.2e-35 Identity = 76/127 (59.84%), Postives = 94/127 (74.02%), Query Frame = 1
BLAST of Cucsa.255320 vs. Swiss-Prot
Match: PTI5_SOLLC (Pathogenesis-related genes transcriptional activator PTI5 OS=Solanum lycopersicum GN=PTI5 PE=2 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 7.7e-22 Identity = 55/101 (54.46%), Postives = 68/101 (67.33%), Query Frame = 1
BLAST of Cucsa.255320 vs. TrEMBL
Match: A0A0A0L9V5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G135630 PE=4 SV=1) HSP 1 Score: 271.9 bits (694), Expect = 4.0e-70 Identity = 133/133 (100.00%), Postives = 133/133 (100.00%), Query Frame = 1
BLAST of Cucsa.255320 vs. TrEMBL
Match: M1BG41_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400017233 PE=4 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 2.0e-40 Identity = 90/138 (65.22%), Postives = 102/138 (73.91%), Query Frame = 1
BLAST of Cucsa.255320 vs. TrEMBL
Match: K4CW17_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 172.9 bits (437), Expect = 2.6e-40 Identity = 87/123 (70.73%), Postives = 97/123 (78.86%), Query Frame = 1
BLAST of Cucsa.255320 vs. TrEMBL
Match: A0A151T168_CAJCA (Ethylene-responsive transcription factor ERF098 family OS=Cajanus cajan GN=KK1_023217 PE=4 SV=1) HSP 1 Score: 171.8 bits (434), Expect = 5.7e-40 Identity = 91/144 (63.19%), Postives = 105/144 (72.92%), Query Frame = 1
BLAST of Cucsa.255320 vs. TrEMBL
Match: B9STH3_RICCO (Ethylene-responsive transcription factor, putative OS=Ricinus communis GN=RCOM_0491600 PE=4 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 7.4e-40 Identity = 84/127 (66.14%), Postives = 98/127 (77.17%), Query Frame = 1
BLAST of Cucsa.255320 vs. TAIR10
Match: AT1G04370.1 (AT1G04370.1 Ethylene-responsive element binding factor 14) HSP 1 Score: 157.1 bits (396), Expect = 7.4e-39 Identity = 78/129 (60.47%), Postives = 99/129 (76.74%), Query Frame = 1
BLAST of Cucsa.255320 vs. TAIR10
Match: AT3G23230.1 (AT3G23230.1 Integrase-type DNA-binding superfamily protein) HSP 1 Score: 153.3 bits (386), Expect = 1.1e-37 Identity = 82/131 (62.60%), Postives = 92/131 (70.23%), Query Frame = 1
BLAST of Cucsa.255320 vs. TAIR10
Match: AT5G43410.1 (AT5G43410.1 Integrase-type DNA-binding superfamily protein) HSP 1 Score: 152.5 bits (384), Expect = 1.8e-37 Identity = 78/133 (58.65%), Postives = 97/133 (72.93%), Query Frame = 1
BLAST of Cucsa.255320 vs. TAIR10
Match: AT3G23220.1 (AT3G23220.1 Integrase-type DNA-binding superfamily protein) HSP 1 Score: 150.6 bits (379), Expect = 6.9e-37 Identity = 76/127 (59.84%), Postives = 94/127 (74.02%), Query Frame = 1
BLAST of Cucsa.255320 vs. TAIR10
Match: AT5G47220.1 (AT5G47220.1 ethylene responsive element binding factor 2) HSP 1 Score: 103.6 bits (257), Expect = 9.7e-23 Identity = 59/126 (46.83%), Postives = 78/126 (61.90%), Query Frame = 1
BLAST of Cucsa.255320 vs. NCBI nr
Match: gi|449433255|ref|XP_004134413.1| (PREDICTED: ethylene-responsive transcription factor 14 [Cucumis sativus]) HSP 1 Score: 271.9 bits (694), Expect = 5.8e-70 Identity = 133/133 (100.00%), Postives = 133/133 (100.00%), Query Frame = 1
BLAST of Cucsa.255320 vs. NCBI nr
Match: gi|659076165|ref|XP_008438537.1| (PREDICTED: ethylene-responsive transcription factor ERF096 [Cucumis melo]) HSP 1 Score: 246.5 bits (628), Expect = 2.6e-62 Identity = 126/138 (91.30%), Postives = 128/138 (92.75%), Query Frame = 1
BLAST of Cucsa.255320 vs. NCBI nr
Match: gi|565375997|ref|XP_006354501.1| (PREDICTED: ethylene-responsive transcription factor ERF096-like [Solanum tuberosum]) HSP 1 Score: 173.3 bits (438), Expect = 2.8e-40 Identity = 90/138 (65.22%), Postives = 102/138 (73.91%), Query Frame = 1
BLAST of Cucsa.255320 vs. NCBI nr
Match: gi|659121388|ref|XP_008460635.1| (PREDICTED: ethylene-responsive transcription factor ERF098 [Cucumis melo]) HSP 1 Score: 173.3 bits (438), Expect = 2.8e-40 Identity = 88/131 (67.18%), Postives = 98/131 (74.81%), Query Frame = 1
BLAST of Cucsa.255320 vs. NCBI nr
Match: gi|460404916|ref|XP_004247924.1| (PREDICTED: ethylene-responsive transcription factor ERF096 [Solanum lycopersicum]) HSP 1 Score: 172.9 bits (437), Expect = 3.7e-40 Identity = 87/123 (70.73%), Postives = 97/123 (78.86%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|