Csa7G390080 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGGAATTCAGTGTGACATTGTTGAAGATTTTTCAAGCGATCAAGGAGCAAAACCTTTGGAATGTGCCTATTTGGATGCCGTTATCGACGAGTTTAGATGGGGAGAAGAAAAGATCCGTGTTGGGATGGGAAGAGAAGCAAAAGAATTGGATTGAAATGCAGAAGGAGGAAGATGAAGGTCGACACCGAGGAAATTTATTCGACTCTCTATTTTTTACAGAAAATCGAAGATACGATAAGATGAATAAGTAA ATGGTGGAATTCAGTGTGACATTGTTGAAGATTTTTCAAGCGATCAAGGAGCAAAACCTTTGGAATGTGCCTATTTGGATGCCGTTATCGACGAGTTTAGATGGGGAGAAGAAAAGATCCGTGTTGGGATGGGAAGAGAAGCAAAAGAATTGGATTGAAATGCAGAAGGAGGAAGATGAAGAAAATCGAAGATACGATAAGATGAATAAGTAA ATGGTGGAATTCAGTGTGACATTGTTGAAGATTTTTCAAGCGATCAAGGAGCAAAACCTTTGGAATGTGCCTATTTGGATGCCGTTATCGACGAGTTTAGATGGGGAGAAGAAAAGATCCGTGTTGGGATGGGAAGAGAAGCAAAAGAATTGGATTGAAATGCAGAAGGAGGAAGATGAAGAAAATCGAAGATACGATAAGATGAATAAGTAA MVEFSVTLLKIFQAIKEQNLWNVPIWMPLSTSLDGEKKRSVLGWEEKQKNWIEMQKEEDEENRRYDKMNK*
BLAST of Csa7G390080 vs. Swiss-Prot
Match: Y5278_ARATH (Uncharacterized protein PAM68-like OS=Arabidopsis thaliana GN=At5g52780 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 2.8e-07 Identity = 25/72 (34.72%), Postives = 40/72 (55.56%), Query Frame = 1
BLAST of Csa7G390080 vs. TrEMBL
Match: A0A0A0K7F4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G390080 PE=4 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 3.6e-33 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of Csa7G390080 vs. TrEMBL
Match: A0A0A0LLM4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G213970 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.6e-17 Identity = 50/79 (63.29%), Postives = 53/79 (67.09%), Query Frame = 1
BLAST of Csa7G390080 vs. TrEMBL
Match: M5X516_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa026735mg PE=4 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 7.3e-10 Identity = 34/75 (45.33%), Postives = 45/75 (60.00%), Query Frame = 1
BLAST of Csa7G390080 vs. TrEMBL
Match: A0A068UA19_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00020082001 PE=4 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 7.3e-10 Identity = 35/75 (46.67%), Postives = 47/75 (62.67%), Query Frame = 1
BLAST of Csa7G390080 vs. TrEMBL
Match: W9RS46_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_014227 PE=4 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.8e-08 Identity = 32/73 (43.84%), Postives = 43/73 (58.90%), Query Frame = 1
BLAST of Csa7G390080 vs. TAIR10
Match: AT5G52780.1 (AT5G52780.1 Protein of unknown function (DUF3464)) HSP 1 Score: 55.5 bits (132), Expect = 1.6e-08 Identity = 25/72 (34.72%), Postives = 40/72 (55.56%), Query Frame = 1
BLAST of Csa7G390080 vs. NCBI nr
Match: gi|700189596|gb|KGN44829.1| (hypothetical protein Csa_7G390080 [Cucumis sativus]) HSP 1 Score: 148.3 bits (373), Expect = 5.1e-33 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of Csa7G390080 vs. NCBI nr
Match: gi|449465705|ref|XP_004150568.1| (PREDICTED: uncharacterized protein PAM68-like [Cucumis sativus]) HSP 1 Score: 95.1 bits (235), Expect = 5.2e-17 Identity = 50/79 (63.29%), Postives = 53/79 (67.09%), Query Frame = 1
BLAST of Csa7G390080 vs. NCBI nr
Match: gi|659077646|ref|XP_008439311.1| (PREDICTED: uncharacterized protein PAM68-like [Cucumis melo]) HSP 1 Score: 94.7 bits (234), Expect = 6.7e-17 Identity = 49/79 (62.03%), Postives = 54/79 (68.35%), Query Frame = 1
BLAST of Csa7G390080 vs. NCBI nr
Match: gi|694400924|ref|XP_009375538.1| (PREDICTED: uncharacterized protein PAM68-like [Pyrus x bretschneideri]) HSP 1 Score: 72.8 bits (177), Expect = 2.7e-10 Identity = 36/73 (49.32%), Postives = 45/73 (61.64%), Query Frame = 1
BLAST of Csa7G390080 vs. NCBI nr
Match: gi|658037350|ref|XP_008354247.1| (PREDICTED: uncharacterized protein PAM68-like [Malus domestica]) HSP 1 Score: 72.8 bits (177), Expect = 2.7e-10 Identity = 36/73 (49.32%), Postives = 45/73 (61.64%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|