Csa7G353520.1 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGCATGCAGGAATCAAATTGGAAGGTTAGCAACGTACAGTTCAAGAACATTCGGGGAACATCGACAACGAATGTGGCAGTGTTGTTGGAGTGCAGCAAATTGTTTCCATGCGAGGGGGTAGAGTTGAGGGACATTAACTTGAGTTATGGAGGCACCAACTTGAGGAATACAACCATTGTTTCTTCATGTTCGAATGCAAAGATTGCTACTTTTGGGGTTCAAAACCCACCACCTTGTGTTGTATAA ATGTGCATGCAGGAATCAAATTGGAAGGTTAGCAACGTACAGTTCAAGAACATTCGGGGAACATCGACAACGAATGTGGCAGTGTTGTTGGAGTGCAGCAAATTGTTTCCATGCGAGGGGGTAGAGTTGAGGGACATTAACTTGAGTTATGGAGGCACCAACTTGAGGAATACAACCATTGTTTCTTCATGTTCGAATGCAAAGATTGCTACTTTTGGGGTTCAAAACCCACCACCTTGTGTTGTATAA ATGTGCATGCAGGAATCAAATTGGAAGGTTAGCAACGTACAGTTCAAGAACATTCGGGGAACATCGACAACGAATGTGGCAGTGTTGTTGGAGTGCAGCAAATTGTTTCCATGCGAGGGGGTAGAGTTGAGGGACATTAACTTGAGTTATGGAGGCACCAACTTGAGGAATACAACCATTGTTTCTTCATGTTCGAATGCAAAGATTGCTACTTTTGGGGTTCAAAACCCACCACCTTGTGTTGTATAA MCMQESNWKVSNVQFKNIRGTSTTNVAVLLECSKLFPCEGVELRDINLSYGGTNLRNTTIVSSCSNAKIATFGVQNPPPCVV*
BLAST of Csa7G353520.1 vs. Swiss-Prot
Match: PGLR_OENOR (Exopolygalacturonase (Fragment) OS=Oenothera organensis PE=2 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.3e-11 Identity = 38/75 (50.67%), Postives = 43/75 (57.33%), Query Frame = 1
BLAST of Csa7G353520.1 vs. Swiss-Prot
Match: PGLR_TOBAC (Polygalacturonase OS=Nicotiana tabacum GN=PG1 PE=2 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.9e-10 Identity = 36/75 (48.00%), Postives = 44/75 (58.67%), Query Frame = 1
BLAST of Csa7G353520.1 vs. Swiss-Prot
Match: PGLR_GOSBA (Polygalacturonase OS=Gossypium barbadense GN=G9 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 4.2e-10 Identity = 34/77 (44.16%), Postives = 40/77 (51.95%), Query Frame = 1
BLAST of Csa7G353520.1 vs. Swiss-Prot
Match: PGLR_GOSHI (Polygalacturonase OS=Gossypium hirsutum GN=G9 PE=2 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 7.1e-10 Identity = 34/77 (44.16%), Postives = 40/77 (51.95%), Query Frame = 1
BLAST of Csa7G353520.1 vs. Swiss-Prot
Match: PGLR2_PLAAC (Exopolygalacturonase (Fragment) OS=Platanus acerifolia GN=plaa2 PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 4.6e-09 Identity = 34/72 (47.22%), Postives = 42/72 (58.33%), Query Frame = 1
BLAST of Csa7G353520.1 vs. TrEMBL
Match: A0A0A0KA01_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G353520 PE=3 SV=1) HSP 1 Score: 171.8 bits (434), Expect = 3.5e-40 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of Csa7G353520.1 vs. TrEMBL
Match: A0A0A0KMA6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G222970 PE=3 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 8.1e-37 Identity = 77/79 (97.47%), Postives = 78/79 (98.73%), Query Frame = 1
BLAST of Csa7G353520.1 vs. TrEMBL
Match: A0A0A0K7V3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G398210 PE=3 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 4.5e-35 Identity = 72/78 (92.31%), Postives = 77/78 (98.72%), Query Frame = 1
BLAST of Csa7G353520.1 vs. TrEMBL
Match: A0A0A0K5G0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G375750 PE=3 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 1.1e-28 Identity = 62/77 (80.52%), Postives = 68/77 (88.31%), Query Frame = 1
BLAST of Csa7G353520.1 vs. TrEMBL
Match: A0A151U4K7_CAJCA (Exopolygalacturonase clone GBGE184 family OS=Cajanus cajan GN=KK1_006903 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 3.8e-18 Identity = 46/81 (56.79%), Postives = 57/81 (70.37%), Query Frame = 1
BLAST of Csa7G353520.1 vs. TAIR10
Match: AT2G15450.1 (AT2G15450.1 Pectin lyase-like superfamily protein) HSP 1 Score: 64.3 bits (155), Expect = 4.0e-11 Identity = 33/77 (42.86%), Postives = 45/77 (58.44%), Query Frame = 1
BLAST of Csa7G353520.1 vs. TAIR10
Match: AT4G18180.1 (AT4G18180.1 Pectin lyase-like superfamily protein) HSP 1 Score: 63.5 bits (153), Expect = 6.9e-11 Identity = 36/83 (43.37%), Postives = 47/83 (56.63%), Query Frame = 1
BLAST of Csa7G353520.1 vs. TAIR10
Match: AT1G05660.1 (AT1G05660.1 Pectin lyase-like superfamily protein) HSP 1 Score: 61.2 bits (147), Expect = 3.4e-10 Identity = 33/76 (43.42%), Postives = 41/76 (53.95%), Query Frame = 1
BLAST of Csa7G353520.1 vs. TAIR10
Match: AT3G07820.1 (AT3G07820.1 Pectin lyase-like superfamily protein) HSP 1 Score: 60.8 bits (146), Expect = 4.4e-10 Identity = 33/75 (44.00%), Postives = 40/75 (53.33%), Query Frame = 1
BLAST of Csa7G353520.1 vs. TAIR10
Match: AT3G57510.1 (AT3G57510.1 Pectin lyase-like superfamily protein) HSP 1 Score: 60.5 bits (145), Expect = 5.8e-10 Identity = 31/74 (41.89%), Postives = 43/74 (58.11%), Query Frame = 1
BLAST of Csa7G353520.1 vs. NCBI nr
Match: gi|700189408|gb|KGN44641.1| (hypothetical protein Csa_7G353520 [Cucumis sativus]) HSP 1 Score: 171.8 bits (434), Expect = 5.1e-40 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of Csa7G353520.1 vs. NCBI nr
Match: gi|778708423|ref|XP_011656188.1| (PREDICTED: exopolygalacturonase-like [Cucumis sativus]) HSP 1 Score: 160.6 bits (405), Expect = 1.2e-36 Identity = 77/79 (97.47%), Postives = 78/79 (98.73%), Query Frame = 1
BLAST of Csa7G353520.1 vs. NCBI nr
Match: gi|700195561|gb|KGN50738.1| (hypothetical protein Csa_5G222970 [Cucumis sativus]) HSP 1 Score: 160.6 bits (405), Expect = 1.2e-36 Identity = 77/79 (97.47%), Postives = 78/79 (98.73%), Query Frame = 1
BLAST of Csa7G353520.1 vs. NCBI nr
Match: gi|700189726|gb|KGN44959.1| (hypothetical protein Csa_7G398210 [Cucumis sativus]) HSP 1 Score: 154.8 bits (390), Expect = 6.4e-35 Identity = 72/78 (92.31%), Postives = 77/78 (98.72%), Query Frame = 1
BLAST of Csa7G353520.1 vs. NCBI nr
Match: gi|659101498|ref|XP_008451635.1| (PREDICTED: exopolygalacturonase-like [Cucumis melo]) HSP 1 Score: 141.0 bits (354), Expect = 9.6e-31 Identity = 66/79 (83.54%), Postives = 73/79 (92.41%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|