MELO3C035316.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideCDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAGAATTTGTCAGTGGTGTCAAAGGAATAGCCTTAAATCTTGAGAATGAGAATGTATGGATTGTTGTCTTTGGTAGTGATATCGCTATTAAAGAAGGAGATCTTGTCAAGCACACTGGATCGATTGTGGATATTCCAGCAAGGTTATGCTTGGGTGTATGGTCGGCACCTTGGGAGCACCTATTGATGGAAGAGGGGCTTTCAGCGATCATGAGCGAAGACGTATCAAAGTGAAAGCCCTTGGGATAATTTAACGTAAATCAGTGCACGAGCCTATGGAAATAGGGTTAAAAGCGGTGGATAGCCTGGTTCCTGTAGGTAAGAGCCAACGAGAACTGATAATCAAGAAGCGA ATGGTAGAATTTGTCAGTGGTGTCAAAGGAATAGCCTTAAATCTTGAGAATGAGAATGTATGGATTGTTGTCTTTGGTAGTGATATCGCTATTAAAGAAGGAGATCTTGTCAAGCACACTGGATCGATTGTGGATATTCCAGCAAGGTTATGCTTGGGTGTATGGTCGGCACCTTGGGAGCACCTATTGATGGAAGAGGGGCTTTCAGCGATCATGAGCGAAGACGTATCAAAGTGAAAGCCCTTGGGATAATTTAACGTAAATCAGTGCACGAGCCTATGGAAATAGGGTTAAAAGCGGTGGATAGCCTGGTTCCTGTAGGTAAGAGCCAACGAGAACTGATAATCAAGAAGCGA ATGGTAGAATTTGTCAGTGGTGTCAAAGGAATAGCCTTAAATCTTGAGAATGAGAATGTATGGATTGTTGTCTTTGGTAGTGATATCGCTATTAAAGAAGGAGATCTTGTCAAGCACACTGGATCGATTGTGGATATTCCAGCAAGGTTATGCTTGGGTGTATGGTCGGCACCTTGGGAGCACCTATTGATGGAAGAGGGGCTTTCAGCGATCATGAGCGAAGACGTATCAAAGTGA MVEFVSGVKGIALNLENENVWIVVFGSDIAIKEGDLVKHTGSIVDIPARLCLGVWSAPWEHLLMEEGLSAIMSEDVSK
BLAST of MELO3C035316.2.1 vs. NCBI nr
Match: KGN50911.1 (hypothetical protein Csa_5G321490 [Cucumis sativus]) HSP 1 Score: 109.8 bits (273), Expect = 4.3e-21 Identity = 54/68 (79.41%), Postives = 59/68 (86.76%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. NCBI nr
Match: AAF17049.1 (ATPase alpha subunit, partial (mitochondrion) [Alisma plantago-aquatica]) HSP 1 Score: 90.1 bits (222), Expect = 3.5e-15 Identity = 45/52 (86.54%), Postives = 46/52 (88.46%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. NCBI nr
Match: ABI75160.1 (ATPase alpha subunit, partial (mitochondrion) [Baldellia ranunculoides]) HSP 1 Score: 89.0 bits (219), Expect = 7.9e-15 Identity = 44/52 (84.62%), Postives = 46/52 (88.46%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. NCBI nr
Match: ADQ28320.1 (ATPase subunit 1, partial (mitochondrion) [Luronium natans]) HSP 1 Score: 88.2 bits (217), Expect = 1.3e-14 Identity = 44/52 (84.62%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. NCBI nr
Match: ANY30762.1 (ATPase subunit 1, partial (mitochondrion) [Luronium natans]) HSP 1 Score: 88.2 bits (217), Expect = 1.3e-14 Identity = 44/52 (84.62%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. TAIR10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein) HSP 1 Score: 79.3 bits (194), Expect = 1.1e-15 Identity = 39/48 (81.25%), Postives = 42/48 (87.50%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. TAIR10
Match: ATMG01190.1 (ATP synthase subunit 1) HSP 1 Score: 79.3 bits (194), Expect = 1.1e-15 Identity = 39/48 (81.25%), Postives = 42/48 (87.50%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. TAIR10
Match: ATCG00120.1 (ATP synthase subunit alpha) HSP 1 Score: 52.0 bits (123), Expect = 1.9e-07 Identity = 25/47 (53.19%), Postives = 31/47 (65.96%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. Swiss-Prot
Match: sp|Q06735|ATPAM_BETVU (ATP synthase subunit alpha, mitochondrial OS=Beta vulgaris OX=161934 GN=ATPA PE=3 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.7e-16 Identity = 43/48 (89.58%), Postives = 44/48 (91.67%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. Swiss-Prot
Match: sp|P18260|ATPAM_HELAN (ATP synthase subunit alpha, mitochondrial OS=Helianthus annuus OX=4232 GN=ATPA PE=3 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.7e-16 Identity = 43/48 (89.58%), Postives = 44/48 (91.67%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. Swiss-Prot
Match: sp|P05494|ATPAM_MAIZE (ATP synthase subunit alpha, mitochondrial OS=Zea mays OX=4577 GN=ATPA PE=3 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.7e-16 Identity = 43/48 (89.58%), Postives = 44/48 (91.67%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. Swiss-Prot
Match: sp|P05495|ATPAM_NICPL (ATP synthase subunit alpha, mitochondrial OS=Nicotiana plumbaginifolia OX=4092 GN=ATPA PE=3 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.7e-16 Identity = 43/48 (89.58%), Postives = 44/48 (91.67%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. Swiss-Prot
Match: sp|P05492|ATPAM_OENBI (ATP synthase subunit alpha, mitochondrial OS=Oenothera biennis OX=3942 GN=ATPA PE=3 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.7e-16 Identity = 43/48 (89.58%), Postives = 44/48 (91.67%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. TrEMBL
Match: tr|A0A0A0KT56|A0A0A0KT56_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G321490 PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 2.9e-21 Identity = 54/68 (79.41%), Postives = 59/68 (86.76%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. TrEMBL
Match: tr|Q9T713|Q9T713_ALIPL (ATP synthase subunit alpha (Fragment) OS=Alisma plantago-aquatica OX=15000 GN=atp1 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 2.3e-15 Identity = 45/52 (86.54%), Postives = 46/52 (88.46%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. TrEMBL
Match: tr|A7J178|A7J178_BALRA (ATP synthase subunit alpha (Fragment) OS=Baldellia ranunculoides OX=55328 GN=atp1 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 5.2e-15 Identity = 44/52 (84.62%), Postives = 46/52 (88.46%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. TrEMBL
Match: tr|I1SZK5|I1SZK5_9LILI (ATP synthase subunit alpha (Fragment) OS=Alisma gramineum OX=365729 GN=atp1 PE=4 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 8.9e-15 Identity = 44/51 (86.27%), Postives = 45/51 (88.24%), Query Frame = 0
BLAST of MELO3C035316.2.1 vs. TrEMBL
Match: tr|A0A1B2ART0|A0A1B2ART0_LURNA (ATP synthase subunit alpha (Fragment) OS=Luronium natans OX=55479 GN=atp1 PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 8.9e-15 Identity = 44/52 (84.62%), Postives = 45/52 (86.54%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|