MELO3C031703.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.CAACGATATTCGTCTTGTGCTAAGAGCTATGATGAAGCTGTTGGTGACATAGAAAATGCTCTAAAGGACTTGGCACTTGGTGACTTTAATGGTGTCAATATTGTAACTTCTAGTGCCATGACCGAGATTGATGATTGTCAGGATAAGTTTATGCAACCACCGAAAGGATACGTCGTTGCTTTTGAAGAATAACAAGACTCTAAATGATATATGCAGCATTATTTTG CAACGATATTCGTCTTGTGCTAAGAGCTATGATGAAGCTGTTGGTGACATAGAAAATGCTCTAAAGGACTTGGCACTTGGTGACTTTAATGGTGTCAATATTGTAACTTCTAGTGCCATGACCGAGATTGATGATTGTCAGGATAAGTTTATGCAACCACCGAAAGGATACGTCGTTGCTTTTGAAGAATAACAAGACTCTAAATGATATATGCAGCATTATTTTG CAACGATATTCGTCTTGTGCTAAGAGCTATGATGAAGCTGTTGGTGACATAGAAAATGCTCTAAAGGACTTGGCACTTGGTGACTTTAATGGTGTCAATATTGTAACTTCTAGTGCCATGACCGAGATTGATGATTGTCAGGATAAGTTTATGCAACCACCGAAAGGATACGTCGTTGCTTTTGAAGAATAA QRYSSCAKSYDEAVGDIENALKDLALGDFNGVNIVTSSAMTEIDDCQDKFMQPPKGYVVAFEE
BLAST of MELO3C031703.2.1 vs. NCBI nr
Match: XP_008444309.1 (PREDICTED: pectinesterase inhibitor-like [Cucumis melo]) HSP 1 Score: 105.1 bits (261), Expect = 8.6e-20 Identity = 50/55 (90.91%), Postives = 50/55 (90.91%), Query Frame = 0
BLAST of MELO3C031703.2.1 vs. NCBI nr
Match: XP_008456812.1 (PREDICTED: pectinesterase inhibitor-like [Cucumis melo]) HSP 1 Score: 104.8 bits (260), Expect = 1.1e-19 Identity = 49/55 (89.09%), Postives = 52/55 (94.55%), Query Frame = 0
BLAST of MELO3C031703.2.1 vs. NCBI nr
Match: XP_008464144.1 (PREDICTED: pectinesterase inhibitor-like [Cucumis melo]) HSP 1 Score: 104.4 bits (259), Expect = 1.5e-19 Identity = 49/55 (89.09%), Postives = 50/55 (90.91%), Query Frame = 0
BLAST of MELO3C031703.2.1 vs. NCBI nr
Match: XP_008456811.1 (PREDICTED: pectinesterase inhibitor-like [Cucumis melo]) HSP 1 Score: 103.6 bits (257), Expect = 2.5e-19 Identity = 49/55 (89.09%), Postives = 50/55 (90.91%), Query Frame = 0
BLAST of MELO3C031703.2.1 vs. NCBI nr
Match: XP_008465572.1 (PREDICTED: pectinesterase inhibitor-like [Cucumis melo]) HSP 1 Score: 103.6 bits (257), Expect = 2.5e-19 Identity = 49/55 (89.09%), Postives = 51/55 (92.73%), Query Frame = 0
BLAST of MELO3C031703.2.1 vs. TAIR10
Match: AT1G48020.1 (pectin methylesterase inhibitor 1) HSP 1 Score: 43.9 bits (102), Expect = 4.3e-05 Identity = 19/46 (41.30%), Postives = 28/46 (60.87%), Query Frame = 0
BLAST of MELO3C031703.2.1 vs. Swiss-Prot
Match: sp|Q9LNF2|PMEI1_ARATH (Pectinesterase inhibitor 1 OS=Arabidopsis thaliana OX=3702 GN=PMEI1 PE=1 SV=1) HSP 1 Score: 43.9 bits (102), Expect = 7.7e-04 Identity = 19/46 (41.30%), Postives = 28/46 (60.87%), Query Frame = 0
BLAST of MELO3C031703.2.1 vs. TrEMBL
Match: tr|A0A1S3B9K9|A0A1S3B9K9_CUCME (pectinesterase inhibitor-like OS=Cucumis melo OX=3656 GN=LOC103487678 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 5.7e-20 Identity = 50/55 (90.91%), Postives = 50/55 (90.91%), Query Frame = 0
BLAST of MELO3C031703.2.1 vs. TrEMBL
Match: tr|A0A1S3C441|A0A1S3C441_CUCME (pectinesterase inhibitor-like OS=Cucumis melo OX=3656 GN=LOC103496650 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 7.4e-20 Identity = 49/55 (89.09%), Postives = 52/55 (94.55%), Query Frame = 0
BLAST of MELO3C031703.2.1 vs. TrEMBL
Match: tr|A0A1S3CKV4|A0A1S3CKV4_CUCME (pectinesterase inhibitor-like OS=Cucumis melo OX=3656 GN=LOC103502096 PE=4 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 9.7e-20 Identity = 49/55 (89.09%), Postives = 50/55 (90.91%), Query Frame = 0
BLAST of MELO3C031703.2.1 vs. TrEMBL
Match: tr|A0A1S3C476|A0A1S3C476_CUCME (pectinesterase inhibitor-like OS=Cucumis melo OX=3656 GN=LOC103496649 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.7e-19 Identity = 49/55 (89.09%), Postives = 50/55 (90.91%), Query Frame = 0
BLAST of MELO3C031703.2.1 vs. TrEMBL
Match: tr|A0A1S3CP37|A0A1S3CP37_CUCME (pectinesterase inhibitor-like OS=Cucumis melo OX=3656 GN=LOC103503207 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.7e-19 Identity = 49/55 (89.09%), Postives = 51/55 (92.73%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|