MELO3C031664.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGATTGACATTTACCAAGAGCGCTGGAACTAGAACAACGATTAACACTTTCAGAAAAGGTGATTTGTTAGGGGAGCAACTATTGAATTGGGTAGTGGGAAATCTTCTTGTATCTGAAATTCCTTTGTCCAAATGTTCTCTCAAGACACATACCCAAATGGGAGCCTTCGCTCTTAAGGCTATCGATCTACAATATCATACCAAGTGGGACACAAATACGTATAGGTTAAGTTAA ATGGGATTGACATTTACCAAGAGCGCTGGAACTAGAACAACGATTAACACTTTCAGAAAAGGTGATTTGTTAGGGGAGCAACTATTGAATTGGGTAGTGGGAAATCTTCTTGTATCTGAAATTCCTTTGTCCAAATGTTCTCTCAAGACACATACCCAAATGGGAGCCTTCGCTCTTAAGGCTATCGATCTACAATATCATACCAAGTGGGACACAAATACGTATAGGTTAAGTTAA ATGGGATTGACATTTACCAAGAGCGCTGGAACTAGAACAACGATTAACACTTTCAGAAAAGGTGATTTGTTAGGGGAGCAACTATTGAATTGGGTAGTGGGAAATCTTCTTGTATCTGAAATTCCTTTGTCCAAATGTTCTCTCAAGACACATACCCAAATGGGAGCCTTCGCTCTTAAGGCTATCGATCTACAATATCATACCAAGTGGGACACAAATACGTATAGGTTAAGTTAA MGLTFTKSAGTRTTINTFRKGDLLGEQLLNWVVGNLLVSEIPLSKCSLKTHTQMGAFALKAIDLQYHTKWDTNTYRLS
BLAST of MELO3C031664.2.1 vs. NCBI nr
Match: XP_008449547.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X1 [Cucumis melo]) HSP 1 Score: 132.5 bits (332), Expect = 6.2e-28 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664.2.1 vs. NCBI nr
Match: XP_016900693.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X2 [Cucumis melo]) HSP 1 Score: 132.5 bits (332), Expect = 6.2e-28 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664.2.1 vs. NCBI nr
Match: XP_016900694.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X3 [Cucumis melo] >XP_016900695.1 PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X3 [Cucumis melo]) HSP 1 Score: 132.5 bits (332), Expect = 6.2e-28 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664.2.1 vs. NCBI nr
Match: XP_011651603.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X1 [Cucumis sativus]) HSP 1 Score: 123.6 bits (309), Expect = 2.9e-25 Identity = 61/78 (78.21%), Postives = 64/78 (82.05%), Query Frame = 0
BLAST of MELO3C031664.2.1 vs. NCBI nr
Match: XP_011651604.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X2 [Cucumis sativus]) HSP 1 Score: 123.6 bits (309), Expect = 2.9e-25 Identity = 61/78 (78.21%), Postives = 64/78 (82.05%), Query Frame = 0
BLAST of MELO3C031664.2.1 vs. TAIR10
Match: AT3G48010.1 (cyclic nucleotide-gated channel 16) HSP 1 Score: 43.9 bits (102), Expect = 5.3e-05 Identity = 20/50 (40.00%), Postives = 33/50 (66.00%), Query Frame = 0
BLAST of MELO3C031664.2.1 vs. TAIR10
Match: AT5G53130.1 (cyclic nucleotide gated channel 1) HSP 1 Score: 42.4 bits (98), Expect = 1.5e-04 Identity = 27/84 (32.14%), Postives = 44/84 (52.38%), Query Frame = 0
BLAST of MELO3C031664.2.1 vs. TAIR10
Match: AT1G15990.1 (cyclic nucleotide gated channel 7) HSP 1 Score: 40.0 bits (92), Expect = 7.6e-04 Identity = 18/48 (37.50%), Postives = 31/48 (64.58%), Query Frame = 0
BLAST of MELO3C031664.2.1 vs. TAIR10
Match: AT1G19780.1 (cyclic nucleotide gated channel 8) HSP 1 Score: 40.0 bits (92), Expect = 7.6e-04 Identity = 18/48 (37.50%), Postives = 31/48 (64.58%), Query Frame = 0
BLAST of MELO3C031664.2.1 vs. Swiss-Prot
Match: sp|Q9SU64|CNG16_ARATH (Probable cyclic nucleotide-gated ion channel 16 OS=Arabidopsis thaliana OX=3702 GN=CNGC16 PE=2 SV=1) HSP 1 Score: 43.9 bits (102), Expect = 9.5e-04 Identity = 20/50 (40.00%), Postives = 33/50 (66.00%), Query Frame = 0
BLAST of MELO3C031664.2.1 vs. TrEMBL
Match: tr|A0A1S4DYA3|A0A1S4DYA3_CUCME (cyclic nucleotide-gated ion channel 1-like isoform X3 OS=Cucumis melo OX=3656 GN=LOC103491398 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 4.1e-28 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664.2.1 vs. TrEMBL
Match: tr|A0A1S3BLM4|A0A1S3BLM4_CUCME (cyclic nucleotide-gated ion channel 1-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103491398 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 4.1e-28 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664.2.1 vs. TrEMBL
Match: tr|A0A1S4DXJ0|A0A1S4DXJ0_CUCME (cyclic nucleotide-gated ion channel 1-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103491398 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 4.1e-28 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664.2.1 vs. TrEMBL
Match: tr|W9S9M0|W9S9M0_9ROSA (Uncharacterized protein OS=Morus notabilis OX=981085 GN=L484_002701 PE=4 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 7.1e-04 Identity = 25/62 (40.32%), Postives = 38/62 (61.29%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|