MELO3C028698.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCACAACTGGAGGAGAAAGACTCGGAAAATGGAAGAGATGATTATACGGAAGATGGAACTGTGAGTCTCAAAGGTTTACCTGTCTTAAGATCAAAGACTGGGAGATGGGGAGCCTGTTCCTTCCTTGTTGCT ATGGCACAACTGGAGGAGAAAGACTCGGAAAATGGAAGAGATGATTATACGGAAGATGGAACTGTGAGTCTCAAAGGTTTACCTGTCTTAAGATCAAAGACTGGGAGATGGGGAGCCTGTTCCTTCCTTGTTGCT ATGGCACAACTGGAGGAGAAAGACTCGGAAAATGGAAGAGATGATTATACGGAAGATGGAACTGTGAGTCTCAAAGGTTTACCTGTCTTAAGATCAAAGACTGGGAGATGGGGAGCCTGTTCCTTCCTTGTTGCT MAQLEEKDSENGRDDYTEDGTVSLKGLPVLRSKTGRWGACSFLVA
BLAST of MELO3C028698.2.1 vs. NCBI nr
Match: XP_004152059.1 (PREDICTED: protein NRT1/ PTR FAMILY 5.2-like [Cucumis sativus] >KGN58287.1 hypothetical protein Csa_3G608170 [Cucumis sativus]) HSP 1 Score: 84.7 bits (208), Expect = 8.6e-14 Identity = 40/45 (88.89%), Postives = 42/45 (93.33%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. NCBI nr
Match: XP_008447390.2 (PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.2-like [Cucumis melo]) HSP 1 Score: 84.7 bits (208), Expect = 8.6e-14 Identity = 40/45 (88.89%), Postives = 42/45 (93.33%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. NCBI nr
Match: XP_022931104.1 (protein NRT1/ PTR FAMILY 5.2-like [Cucurbita moschata]) HSP 1 Score: 77.0 bits (188), Expect = 1.8e-11 Identity = 35/44 (79.55%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. NCBI nr
Match: XP_022996421.1 (protein NRT1/ PTR FAMILY 5.2-like [Cucurbita maxima]) HSP 1 Score: 77.0 bits (188), Expect = 1.8e-11 Identity = 35/44 (79.55%), Postives = 40/44 (90.91%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. NCBI nr
Match: XP_023532745.1 (protein NRT1/ PTR FAMILY 5.2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 75.5 bits (184), Expect = 5.2e-11 Identity = 34/44 (77.27%), Postives = 39/44 (88.64%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. TAIR10
Match: AT2G40460.1 (Major facilitator superfamily protein) HSP 1 Score: 52.0 bits (123), Expect = 1.1e-07 Identity = 22/29 (75.86%), Postives = 25/29 (86.21%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. TAIR10
Match: AT5G46040.1 (Major facilitator superfamily protein) HSP 1 Score: 50.4 bits (119), Expect = 3.3e-07 Identity = 22/31 (70.97%), Postives = 26/31 (83.87%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. TAIR10
Match: AT5G46050.1 (peptide transporter 3) HSP 1 Score: 49.7 bits (117), Expect = 5.6e-07 Identity = 22/31 (70.97%), Postives = 25/31 (80.65%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. TAIR10
Match: AT2G02040.1 (peptide transporter 2) HSP 1 Score: 40.0 bits (92), Expect = 4.4e-04 Identity = 15/29 (51.72%), Postives = 19/29 (65.52%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. Swiss-Prot
Match: sp|Q8VZR7|PTR30_ARATH (Protein NRT1/ PTR FAMILY 5.1 OS=Arabidopsis thaliana OX=3702 GN=NPF5.1 PE=2 SV=2) HSP 1 Score: 52.0 bits (123), Expect = 2.0e-06 Identity = 22/29 (75.86%), Postives = 25/29 (86.21%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. Swiss-Prot
Match: sp|Q9FNL8|PTR4_ARATH (Protein NRT1/ PTR FAMILY 5.3 OS=Arabidopsis thaliana OX=3702 GN=NPF5.3 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 5.9e-06 Identity = 22/31 (70.97%), Postives = 26/31 (83.87%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. Swiss-Prot
Match: sp|Q9FNL7|PTR3_ARATH (Protein NRT1/ PTR FAMILY 5.2 OS=Arabidopsis thaliana OX=3702 GN=NPF5.2 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.0e-05 Identity = 22/31 (70.97%), Postives = 25/31 (80.65%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. TrEMBL
Match: tr|A0A1S3BHC2|A0A1S3BHC2_CUCME (LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.2-like OS=Cucumis melo OX=3656 GN=LOC103489849 PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 5.7e-14 Identity = 40/45 (88.89%), Postives = 42/45 (93.33%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. TrEMBL
Match: tr|A0A0A0LC54|A0A0A0LC54_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G608170 PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 5.7e-14 Identity = 40/45 (88.89%), Postives = 42/45 (93.33%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. TrEMBL
Match: tr|A0A061DPK9|A0A061DPK9_THECC (Peptide transporter PTR3-A OS=Theobroma cacao OX=3641 GN=TCM_003950 PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 2.2e-10 Identity = 33/44 (75.00%), Postives = 39/44 (88.64%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. TrEMBL
Match: tr|G7KWE3|G7KWE3_MEDTR (Peptide transporter OS=Medicago truncatula OX=3880 GN=11425206 PE=4 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 5.0e-10 Identity = 31/44 (70.45%), Postives = 37/44 (84.09%), Query Frame = 0
BLAST of MELO3C028698.2.1 vs. TrEMBL
Match: tr|A0A2K3L7H5|A0A2K3L7H5_TRIPR (Peptide transporter PTR3-a-like protein (Fragment) OS=Trifolium pratense OX=57577 GN=L195_g030402 PE=4 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 5.0e-10 Identity = 31/44 (70.45%), Postives = 37/44 (84.09%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|