MELO3C020277T1 (mRNA) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GAAGAAGGGAAGAAAGAAAGAGAAATAAAAAAAAGAAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGTGATTGCCCTAAGTTCCAGATCAATTATCCCTATCAGAATTAGCTGCACAAAAATGGCAGATAGTGGCGTAAACTCAGCCGATTGCGAGAGAATTTTCAAACGATTCGATGCCAATGGCGACGGCAAGATCTCGGCAACAGAGCTGGGCGATGCTTTGAACGGGTTCGGAGTTAGTTCCGAGGATGCCAAGAGGATGATGGACGCCATTGACAAAGATGGCGATGGCTATATTTCCTTCCAAGAATTCTCCGATTTCGCTAAGGATAATCGCGCTTTGATGAAGGATTTCGCCAAGGCGTTTTAGATTTTGTTGTTATTGTTTTTGTTTTTGTTTTTTTTTTTGTTTTGTTTTGTTTTAATGGAAGATCTGATTATATGAATA GAAGAAGGGAAGAAAGAAAGAGAAATAAAAAAAAGAAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGTGATTGCCCTAAGTTCCAGATCAATTATCCCTATCAGAATTAGCTGCACAAAAATGGCAGATAGTGGCGTAAACTCAGCCGATTGCGAGAGAATTTTCAAACGATTCGATGCCAATGGCGACGGCAAGATCTCGGCAACAGAGCTGGGCGATGCTTTGAACGGGTTCGGAGTTAGTTCCGAGGATGCCAAGAGGATGATGGACGCCATTGACAAAGATGGCGATGGCTATATTTCCTTCCAAGAATTCTCCGATTTCGCTAAGGATAATCGCGCTTTGATGAAGGATTTCGCCAAGGCGTTTTAGATTTTGTTGTTATTGTTTTTGTTTTTGTTTTTTTTTTTGTTTTGTTTTGTTTTAATGGAAGATCTGATTATATGAATA ATGGCAGATAGTGGCGTAAACTCAGCCGATTGCGAGAGAATTTTCAAACGATTCGATGCCAATGGCGACGGCAAGATCTCGGCAACAGAGCTGGGCGATGCTTTGAACGGGTTCGGAGTTAGTTCCGAGGATGCCAAGAGGATGATGGACGCCATTGACAAAGATGGCGATGGCTATATTTCCTTCCAAGAATTCTCCGATTTCGCTAAGGATAATCGCGCTTTGATGAAGGATTTCGCCAAGGCGTTTTAG MADSGVNSADCERIFKRFDANGDGKISATELGDALNGFGVSSEDAKRMMDAIDKDGDGYISFQEFSDFAKDNRALMKDFAKAF*
BLAST of MELO3C020277T1 vs. Swiss-Prot
Match: POLC2_BRANA (Polcalcin Bra n 2 OS=Brassica napus PE=1 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 4.4e-23 Identity = 57/84 (67.86%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of MELO3C020277T1 vs. Swiss-Prot
Match: POLC2_BRACM (Polcalcin Bra r 2 OS=Brassica campestris PE=1 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 4.4e-23 Identity = 57/84 (67.86%), Postives = 63/84 (75.00%), Query Frame = 1
BLAST of MELO3C020277T1 vs. Swiss-Prot
Match: CML28_ARATH (Probable calcium-binding protein CML28 OS=Arabidopsis thaliana GN=CML28 PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.3e-22 Identity = 57/84 (67.86%), Postives = 61/84 (72.62%), Query Frame = 1
BLAST of MELO3C020277T1 vs. Swiss-Prot
Match: POLC3_CHEAL (Polcalcin Che a 3 OS=Chenopodium album PE=1 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.2e-20 Identity = 50/82 (60.98%), Postives = 61/82 (74.39%), Query Frame = 1
BLAST of MELO3C020277T1 vs. Swiss-Prot
Match: POLC4_BETPN (Polcalcin Bet v 4 OS=Betula pendula GN=BETV4 PE=1 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.2e-20 Identity = 50/82 (60.98%), Postives = 59/82 (71.95%), Query Frame = 1
BLAST of MELO3C020277T1 vs. TrEMBL
Match: A0A0A0L775_CUCSA (Putative calcium-binding protein CML28 OS=Cucumis sativus GN=Csa_3G345360 PE=4 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 1.4e-36 Identity = 80/83 (96.39%), Postives = 80/83 (96.39%), Query Frame = 1
BLAST of MELO3C020277T1 vs. TrEMBL
Match: D7L0H4_ARALL (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_896345 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.8e-21 Identity = 58/84 (69.05%), Postives = 64/84 (76.19%), Query Frame = 1
BLAST of MELO3C020277T1 vs. TrEMBL
Match: R0GAJ1_9BRAS (Uncharacterized protein OS=Capsella rubella GN=CARUB_v10015861mg PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.8e-21 Identity = 58/84 (69.05%), Postives = 64/84 (76.19%), Query Frame = 1
BLAST of MELO3C020277T1 vs. TrEMBL
Match: A0A078DRY1_BRANA (BnaC03g33420D protein OS=Brassica napus GN=BnaC03g33420D PE=4 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 4.9e-21 Identity = 57/84 (67.86%), Postives = 65/84 (77.38%), Query Frame = 1
BLAST of MELO3C020277T1 vs. TrEMBL
Match: A0A0B2S5H4_GLYSO (Polcalcin Nic t 1 OS=Glycine soja GN=glysoja_016839 PE=4 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 4.9e-21 Identity = 54/84 (64.29%), Postives = 67/84 (79.76%), Query Frame = 1
BLAST of MELO3C020277T1 vs. TAIR10
Match: AT3G03430.1 (AT3G03430.1 Calcium-binding EF-hand family protein) HSP 1 Score: 106.7 bits (265), Expect = 7.1e-24 Identity = 57/84 (67.86%), Postives = 61/84 (72.62%), Query Frame = 1
BLAST of MELO3C020277T1 vs. TAIR10
Match: AT5G17480.1 (AT5G17480.1 pollen calcium-binding protein 1) HSP 1 Score: 98.2 bits (243), Expect = 2.5e-21 Identity = 53/84 (63.10%), Postives = 61/84 (72.62%), Query Frame = 1
BLAST of MELO3C020277T1 vs. TAIR10
Match: AT1G24620.1 (AT1G24620.1 EF hand calcium-binding protein family) HSP 1 Score: 62.0 bits (149), Expect = 2.0e-10 Identity = 31/79 (39.24%), Postives = 46/79 (58.23%), Query Frame = 1
HSP 2 Score: 47.8 bits (112), Expect = 3.9e-06 Identity = 23/53 (43.40%), Postives = 31/53 (58.49%), Query Frame = 1
BLAST of MELO3C020277T1 vs. TAIR10
Match: AT1G73630.1 (AT1G73630.1 EF hand calcium-binding protein family) HSP 1 Score: 60.1 bits (144), Expect = 7.7e-10 Identity = 27/70 (38.57%), Postives = 44/70 (62.86%), Query Frame = 1
BLAST of MELO3C020277T1 vs. TAIR10
Match: AT3G07490.1 (AT3G07490.1 ARF-GAP domain 11) HSP 1 Score: 59.3 bits (142), Expect = 1.3e-09 Identity = 31/83 (37.35%), Postives = 47/83 (56.63%), Query Frame = 1
HSP 2 Score: 50.1 bits (118), Expect = 7.9e-07 Identity = 26/65 (40.00%), Postives = 31/65 (47.69%), Query Frame = 1
BLAST of MELO3C020277T1 vs. NCBI nr
Match: gi|659114464|ref|XP_008457063.1| (PREDICTED: polcalcin Bra n 2-like [Cucumis melo]) HSP 1 Score: 169.1 bits (427), Expect = 3.3e-39 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 1
BLAST of MELO3C020277T1 vs. NCBI nr
Match: gi|449464146|ref|XP_004149790.1| (PREDICTED: probable calcium-binding protein CML28 [Cucumis sativus]) HSP 1 Score: 159.8 bits (403), Expect = 2.0e-36 Identity = 80/83 (96.39%), Postives = 80/83 (96.39%), Query Frame = 1
BLAST of MELO3C020277T1 vs. NCBI nr
Match: gi|565484066|ref|XP_006299673.1| (hypothetical protein CARUB_v10015861mg [Capsella rubella]) HSP 1 Score: 109.0 bits (271), Expect = 4.1e-21 Identity = 58/84 (69.05%), Postives = 64/84 (76.19%), Query Frame = 1
BLAST of MELO3C020277T1 vs. NCBI nr
Match: gi|297828822|ref|XP_002882293.1| (hypothetical protein ARALYDRAFT_896345 [Arabidopsis lyrata subsp. lyrata]) HSP 1 Score: 109.0 bits (271), Expect = 4.1e-21 Identity = 58/84 (69.05%), Postives = 64/84 (76.19%), Query Frame = 1
BLAST of MELO3C020277T1 vs. NCBI nr
Match: gi|59800145|sp|P69198.1|POLC2_BRANA (RecName: Full=Polcalcin Bra n 2; AltName: Full=Calcium-binding pollen allergen Bra n 2; AltName: Allergen=Bra n 2) HSP 1 Score: 108.2 bits (269), Expect = 7.0e-21 Identity = 57/84 (67.86%), Postives = 65/84 (77.38%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
|