MELO3C020213.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGGCGAGCATCTGGAATAACTAATGAATTACAACTCTATTGTACCGCAATTGGTGCATTAGTCTTTGCAGCCTTAATGCTTTTTGCTGGTTGGTTTCATTATCACAAGGCTGCTCCAAAATTGGCTTGGTTCCAAAATGTAGAATCCATGTTGAATCACCATTTAACGGGTCTCCAGTAA ATGTGGCGAGCATCTGGAATAACTAATGAATTACAACTCTATTGTACCGCAATTGGTGCATTAGTCTTTGCAGCCTTAATGCTTTTTGCTGGTTGGTTTCATTATCACAAGGCTGCTCCAAAATTGGCTTGGTTCCAAAATGTAGAATCCATGTTGAATCACCATTTAACGGGTCTCCAGTAA ATGTGGCGAGCATCTGGAATAACTAATGAATTACAACTCTATTGTACCGCAATTGGTGCATTAGTCTTTGCAGCCTTAATGCTTTTTGCTGGTTGGTTTCATTATCACAAGGCTGCTCCAAAATTGGCTTGGTTCCAAAATGTAGAATCCATGTTGAATCACCATTTAACGGGTCTCCAGTAA MWRASGITNELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLAWFQNVESMLNHHLTGLQ
BLAST of MELO3C020213.2.1 vs. NCBI nr
Match: YP_004841783.1 (photosystem I P700 apoprotein A1 [Cucumis melo subsp. melo] >AEM76892.1 photosystem I P700 apoprotein A1 (chloroplast) [Cucumis melo subsp. melo] >ASY96362.1 photosystem I P700 chlorophyll a apoprotein A1 (chloroplast) [Cucumis melo subsp. agrestis] >ASY96449.1 photosystem I P700 chlorophyll a apoprotein A1 (chloroplast) [Cucumis melo subsp. agrestis] >ASY96536.1 photosystem I P700 chlorophyll a apoprotein A1 (chloroplast) [Cucumis melo subsp. agrestis] >ASY96622.1 photosystem I P700 chlorophyll a apoprotein A1 (chloroplast) [Cucumis melo var. conomon] >ASY96710.1 photosystem I P700 chlorophyll a apoprotein A1 (chloroplast) [Cucumis melo var. makuwa] >ASY96797.1 photosystem I P700 chlorophyll a apoprotein A1 (chloroplast) [Cucumis melo var. momordica] >ASY96884.1 photosystem I P700 chlorophyll a apoprotein A1 (chloroplast) [Cucumis melo var. dudaim] >ASY96971.1 photosystem I P700 chlorophyll a apoprotein A1 (chloroplast) [Cucumis melo var. cantalupo] >ASY97058.1 photosystem I P700 chlorophyll a apoprotein A1 (chloroplast) [Cucumis melo var. cantalupo] >ASY97145.1 photosystem I P700 chlorophyll a apoprotein A1 (chloroplast) [Cucumis melo var. inodorus] >ASY97232.1 photosystem I P700 chlorophyll a apoprotein A1 (chloroplast) [Cucumis melo var. cantalupo] >ASY97319.1 photosystem I P700 chlorophyll a apoprotein A1 (chloroplast) [Cucumis melo var. flexuosus] >ASY97406.1 photosystem I P700 chlorophyll a apoprotein A1 (chloroplast) [Cucumis melo var. flexuosus]) HSP 1 Score: 125.9 bits (315), Expect = 4.5e-26 Identity = 58/59 (98.31%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. NCBI nr
Match: AEN56132.1 (hypothetical protein (mitochondrion) [Cucumis melo subsp. melo]) HSP 1 Score: 125.9 bits (315), Expect = 4.5e-26 Identity = 58/59 (98.31%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. NCBI nr
Match: AFA27130.1 (photosystem I P700 apoprotein A1, partial (plastid) [Belosynapsis ciliata]) HSP 1 Score: 124.4 bits (311), Expect = 1.3e-25 Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. NCBI nr
Match: AFA27163.1 (photosystem I P700 apoprotein A1, partial (plastid) [Tradescantia ohiensis]) HSP 1 Score: 124.4 bits (311), Expect = 1.3e-25 Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. NCBI nr
Match: YP_007889716.1 (photosystem I P700 apoprotein A1 (chloroplast) [Vigna angularis] >BAN14920.1 photosystem I P700 apoprotein A1 (chloroplast) [Vigna angularis]) HSP 1 Score: 124.4 bits (311), Expect = 1.3e-25 Identity = 57/59 (96.61%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. TAIR10
Match: ATCG00350.1 (Photosystem I, PsaA/PsaB protein) HSP 1 Score: 120.6 bits (301), Expect = 3.4e-28 Identity = 55/59 (93.22%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. TAIR10
Match: ATCG00340.1 (Photosystem I, PsaA/PsaB protein) HSP 1 Score: 55.1 bits (131), Expect = 1.8e-08 Identity = 26/59 (44.07%), Postives = 34/59 (57.63%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. Swiss-Prot
Match: sp|A4GG97|PSAA_PHAVU (Photosystem I P700 chlorophyll a apoprotein A1 OS=Phaseolus vulgaris OX=3885 GN=psaA PE=3 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 4.3e-28 Identity = 57/59 (96.61%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. Swiss-Prot
Match: sp|Q2QD89|PSAA_CUCSA (Photosystem I P700 chlorophyll a apoprotein A1 OS=Cucumis sativus OX=3659 GN=psaA PE=3 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 5.6e-28 Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. Swiss-Prot
Match: sp|Q0ZJ20|PSAA_VITVI (Photosystem I P700 chlorophyll a apoprotein A1 OS=Vitis vinifera OX=29760 GN=psaA PE=3 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 5.6e-28 Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. Swiss-Prot
Match: sp|Q7YJX2|PSAA_CALFG (Photosystem I P700 chlorophyll a apoprotein A1 OS=Calycanthus floridus var. glaucus OX=212734 GN=psaA PE=3 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 1.2e-27 Identity = 56/59 (94.92%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. Swiss-Prot
Match: sp|Q09X17|PSAA_MORIN (Photosystem I P700 chlorophyll a apoprotein A1 OS=Morus indica OX=248361 GN=psaA PE=3 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 1.6e-27 Identity = 56/59 (94.92%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. TrEMBL
Match: tr|A0A286NG17|A0A286NG17_CUCME (Photosystem I P700 chlorophyll a apoprotein A1 OS=Cucumis melo var. flexuosus OX=1120798 GN=psaA PE=3 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 3.0e-26 Identity = 58/59 (98.31%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. TrEMBL
Match: tr|A0A249RXK9|A0A249RXK9_CUCME (Photosystem I P700 chlorophyll a apoprotein A1 OS=Cucumis melo subsp. agrestis OX=217619 GN=psaA PE=3 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 3.0e-26 Identity = 58/59 (98.31%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. TrEMBL
Match: tr|G3ETY5|G3ETY5_CUCME (Photosystem I P700 chlorophyll a apoprotein A1 OS=Cucumis melo subsp. melo OX=412675 GN=psaA PE=3 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 3.0e-26 Identity = 58/59 (98.31%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. TrEMBL
Match: tr|A0A249RZM5|A0A249RZM5_CUCMN (Photosystem I P700 chlorophyll a apoprotein A1 OS=Cucumis melo var. cantalupensis OX=3658 GN=psaA PE=3 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 3.0e-26 Identity = 58/59 (98.31%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MELO3C020213.2.1 vs. TrEMBL
Match: tr|A0A249RYL0|A0A249RYL0_CUCME (Photosystem I P700 chlorophyll a apoprotein A1 OS=Cucumis melo var. makuwa OX=1194695 GN=psaA PE=3 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 3.0e-26 Identity = 58/59 (98.31%), Postives = 58/59 (98.31%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|