MELO3C018543T1 (mRNA) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCACTCGTCACCGCTCTCTCCACCCTTTGCATCGTTGCACTAACCCTAACCCCAATCGTCGTTGCTCAAAACAGCCCTCAAGACTTCGTCGATGCACACAATGCAGTGCGAGCCAAGGTTGGGGCTGAACCCCTATTTTGGGACGAAGAACTTGAAGCTTACGCTATAAATTAA ATGGCACTCGTCACCGCTCTCTCCACCCTTTGCATCGTTGCACTAACCCTAACCCCAATCGTCGTTGCTCAAAACAGCCCTCAAGACTTCGTCGATGCACACAATGCAGTGCGAGCCAAGGTTGGGGCTGAACCCCTATTTTGGGACGAAGAACTTGAAGCTTACGCTATAAATTAA ATGGCACTCGTCACCGCTCTCTCCACCCTTTGCATCGTTGCACTAACCCTAACCCCAATCGTCGTTGCTCAAAACAGCCCTCAAGACTTCGTCGATGCACACAATGCAGTGCGAGCCAAGGTTGGGGCTGAACCCCTATTTTGGGACGAAGAACTTGAAGCTTACGCTATAAATTAA MALVTALSTLCIVALTLTPIVVAQNSPQDFVDAHNAVRAKVGAEPLFWDEELEAYAIN*
BLAST of MELO3C018543T1 vs. Swiss-Prot
Match: PR1_SAMNI (Pathogenesis-related protein PR-1 type OS=Sambucus nigra PE=2 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 4.3e-09 Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 1
BLAST of MELO3C018543T1 vs. Swiss-Prot
Match: PR1C_TOBAC (Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3) HSP 1 Score: 55.5 bits (132), Expect = 2.4e-07 Identity = 27/61 (44.26%), Postives = 38/61 (62.30%), Query Frame = 1
BLAST of MELO3C018543T1 vs. Swiss-Prot
Match: PR1A_TOBAC (Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 3.1e-07 Identity = 28/61 (45.90%), Postives = 37/61 (60.66%), Query Frame = 1
BLAST of MELO3C018543T1 vs. Swiss-Prot
Match: PR1B_TOBAC (Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 3.4e-06 Identity = 23/36 (63.89%), Postives = 24/36 (66.67%), Query Frame = 1
BLAST of MELO3C018543T1 vs. Swiss-Prot
Match: PRB1_TOBAC (Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 5.8e-06 Identity = 25/58 (43.10%), Postives = 30/58 (51.72%), Query Frame = 1
BLAST of MELO3C018543T1 vs. TrEMBL
Match: A0A0A0K4C6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G070250 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.2e-12 Identity = 37/59 (62.71%), Postives = 49/59 (83.05%), Query Frame = 1
BLAST of MELO3C018543T1 vs. TrEMBL
Match: A0A0A0K2V2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G070240 PE=4 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 1.9e-08 Identity = 31/41 (75.61%), Postives = 34/41 (82.93%), Query Frame = 1
BLAST of MELO3C018543T1 vs. TrEMBL
Match: I1KL97_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_07G186300 PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.6e-07 Identity = 28/47 (59.57%), Postives = 37/47 (78.72%), Query Frame = 1
BLAST of MELO3C018543T1 vs. TrEMBL
Match: M0S7L3_MUSAM (Uncharacterized protein OS=Musa acuminata subsp. malaccensis PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.1e-07 Identity = 28/53 (52.83%), Postives = 37/53 (69.81%), Query Frame = 1
BLAST of MELO3C018543T1 vs. TrEMBL
Match: M0S7L2_MUSAM (Uncharacterized protein OS=Musa acuminata subsp. malaccensis PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.1e-07 Identity = 27/53 (50.94%), Postives = 38/53 (71.70%), Query Frame = 1
BLAST of MELO3C018543T1 vs. TAIR10
Match: AT2G14580.1 (AT2G14580.1 basic pathogenesis-related protein 1) HSP 1 Score: 50.4 bits (119), Expect = 4.3e-07 Identity = 26/59 (44.07%), Postives = 35/59 (59.32%), Query Frame = 1
BLAST of MELO3C018543T1 vs. TAIR10
Match: AT4G33720.1 (AT4G33720.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 50.1 bits (118), Expect = 5.6e-07 Identity = 24/44 (54.55%), Postives = 28/44 (63.64%), Query Frame = 1
BLAST of MELO3C018543T1 vs. TAIR10
Match: AT1G50060.1 (AT1G50060.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 50.1 bits (118), Expect = 5.6e-07 Identity = 23/50 (46.00%), Postives = 32/50 (64.00%), Query Frame = 1
BLAST of MELO3C018543T1 vs. TAIR10
Match: AT4G07820.1 (AT4G07820.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 46.6 bits (109), Expect = 6.2e-06 Identity = 20/44 (45.45%), Postives = 26/44 (59.09%), Query Frame = 1
BLAST of MELO3C018543T1 vs. NCBI nr
Match: gi|449438610|ref|XP_004137081.1| (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis sativus]) HSP 1 Score: 104.8 bits (260), Expect = 5.4e-20 Identity = 51/58 (87.93%), Postives = 52/58 (89.66%), Query Frame = 1
BLAST of MELO3C018543T1 vs. NCBI nr
Match: gi|659110135|ref|XP_008455067.1| (PREDICTED: pathogenesis-related protein 1A-like [Cucumis melo]) HSP 1 Score: 80.1 bits (196), Expect = 1.4e-12 Identity = 35/58 (60.34%), Postives = 47/58 (81.03%), Query Frame = 1
BLAST of MELO3C018543T1 vs. NCBI nr
Match: gi|778724761|ref|XP_004137082.2| (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis sativus]) HSP 1 Score: 79.0 bits (193), Expect = 3.2e-12 Identity = 37/59 (62.71%), Postives = 49/59 (83.05%), Query Frame = 1
BLAST of MELO3C018543T1 vs. NCBI nr
Match: gi|700188595|gb|KGN43828.1| (hypothetical protein Csa_7G070240 [Cucumis sativus]) HSP 1 Score: 65.9 bits (159), Expect = 2.8e-08 Identity = 31/41 (75.61%), Postives = 34/41 (82.93%), Query Frame = 1
BLAST of MELO3C018543T1 vs. NCBI nr
Match: gi|694407728|ref|XP_009378591.1| (PREDICTED: pathogenesis-related leaf protein 4-like [Pyrus x bretschneideri]) HSP 1 Score: 63.5 bits (153), Expect = 1.4e-07 Identity = 28/52 (53.85%), Postives = 38/52 (73.08%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
|