MELO3C017026T3 (mRNA) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGGGCTGCTCAAGAATTGAGTTCGAGGCTTTCTGATTCTTTGAAGGTAAAATTTTCAACTACAATTTTAGTTTGATTCTCTTTCTTATCATGTTATTTTGAACTAATAATTTTGCTTTTCACTTGGTTTCAACATTTGATTGAGTTCAGTGACGAACTGCTTTTGAACATTATTTCACCTTAATTCTTTCTTTGAACTACTTGCTTCTGTTGCATTAGCTTAATCTTGAACTTATCCTCCTTGTCATTTGCAGATAGAGATCTTTCCCTACTCTGTATTTTACATGTTTTTTGAGCAATACCTCAATATATGGAGGACAGCGTTGATCAACCTTGCCATTGCTATTGGTCAGTAA ATGAGGGCTGCTCAAGAATTGAGTTCGAGGCTTTCTGATTCTTTGAAGATAGAGATCTTTCCCTACTCTGTATTTTACATGTTTTTTGAGCAATACCTCAATATATGGAGGACAGCGTTGATCAACCTTGCCATTGCTATTGGTCAGTAA ATGAGGGCTGCTCAAGAATTGAGTTCGAGGCTTTCTGATTCTTTGAAGATAGAGATCTTTCCCTACTCTGTATTTTACATGTTTTTTGAGCAATACCTCAATATATGGAGGACAGCGTTGATCAACCTTGCCATTGCTATTGGTCAGTAA MRAAQELSSRLSDSLKIEIFPYSVFYMFFEQYLNIWRTALINLAIAIGQ*
BLAST of MELO3C017026T3 vs. TrEMBL
Match: A0A0A0L4L2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G658620 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 8.7e-18 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 1
BLAST of MELO3C017026T3 vs. TrEMBL
Match: A0A072V2S3_MEDTR (Niemann-pick C1-like protein OS=Medicago truncatula GN=MTR_3g115450 PE=4 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 4.8e-16 Identity = 43/48 (89.58%), Postives = 47/48 (97.92%), Query Frame = 1
BLAST of MELO3C017026T3 vs. TrEMBL
Match: A0A072VDT9_MEDTR (Niemann-pick C1-like protein OS=Medicago truncatula GN=MTR_3g115450 PE=4 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 4.8e-16 Identity = 43/48 (89.58%), Postives = 47/48 (97.92%), Query Frame = 1
BLAST of MELO3C017026T3 vs. TrEMBL
Match: U5GKA7_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0002s01050g PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 6.2e-16 Identity = 44/49 (89.80%), Postives = 47/49 (95.92%), Query Frame = 1
BLAST of MELO3C017026T3 vs. TrEMBL
Match: B9R8N7_RICCO (Hedgehog receptor, putative OS=Ricinus communis GN=RCOM_1601160 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 8.1e-16 Identity = 43/48 (89.58%), Postives = 47/48 (97.92%), Query Frame = 1
BLAST of MELO3C017026T3 vs. TAIR10
Match: AT4G38350.2 (AT4G38350.2 Patched family protein) HSP 1 Score: 80.9 bits (198), Expect = 2.5e-16 Identity = 38/48 (79.17%), Postives = 42/48 (87.50%), Query Frame = 1
BLAST of MELO3C017026T3 vs. TAIR10
Match: AT1G42470.1 (AT1G42470.1 Patched family protein) HSP 1 Score: 79.7 bits (195), Expect = 5.6e-16 Identity = 37/47 (78.72%), Postives = 43/47 (91.49%), Query Frame = 1
BLAST of MELO3C017026T3 vs. NCBI nr
Match: gi|778697176|ref|XP_011654272.1| (PREDICTED: Niemann-Pick C1 protein isoform X2 [Cucumis sativus]) HSP 1 Score: 96.7 bits (239), Expect = 1.2e-17 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 1
BLAST of MELO3C017026T3 vs. NCBI nr
Match: gi|778697173|ref|XP_011654271.1| (PREDICTED: Niemann-Pick C1 protein isoform X1 [Cucumis sativus]) HSP 1 Score: 96.7 bits (239), Expect = 1.2e-17 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 1
BLAST of MELO3C017026T3 vs. NCBI nr
Match: gi|659104696|ref|XP_008452964.1| (PREDICTED: Niemann-Pick C1 protein isoform X1 [Cucumis melo]) HSP 1 Score: 96.7 bits (239), Expect = 1.2e-17 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 1
BLAST of MELO3C017026T3 vs. NCBI nr
Match: gi|659104698|ref|XP_008452965.1| (PREDICTED: Niemann-Pick C1 protein isoform X2 [Cucumis melo]) HSP 1 Score: 96.7 bits (239), Expect = 1.2e-17 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 1
BLAST of MELO3C017026T3 vs. NCBI nr
Match: gi|645265085|ref|XP_008237984.1| (PREDICTED: Niemann-Pick C1 protein-like [Prunus mume]) HSP 1 Score: 92.0 bits (227), Expect = 3.1e-16 Identity = 45/48 (93.75%), Postives = 48/48 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
|