MELO3C011832T1 (mRNA) Melon (DHL92) v3.5.1 | Cucurbit Genomics Database (CuGenDB)

Overview


Name	MELO3C011832T1
Type	mRNA
Organism	Cucumis melo (Melon (DHL92) v3.5.1)
Description	Retrotransposon protein, putative, Ty3-gypsy subclass
Location	chr10 : 4485863 .. 4486030 (+)
Sequence length	168

Genome Viewer

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGACTAAGTTTGAGGAACGGAAGATTCTTTTCGGGCAGAAACAACAAGAAAGTTTTGAAAGTATTAAGGAGAAGCTCAGTAGTAGTCCTGTTTTGAAGCTACCGGATTTTTCAGCTCTATTTGAGGTTGCGTGGATGCTTGTGGACTTGGCATTGGTGGATTTCTAG

mRNA sequence

ATGACTAAGTTTGAGGAACGGAAGATTCTTTTCGGGCAGAAACAACAAGAAAGTTTTGAAAGTATTAAGGAGAAGCTCAGTAGTAGTCCTGTTTTGAAGCTACCGGATTTTTCAGCTCTATTTGAGGTTGCGTGGATGCTTGTGGACTTGGCATTGGTGGATTTCTAG

Coding sequence (CDS)

ATGACTAAGTTTGAGGAACGGAAGATTCTTTTCGGGCAGAAACAACAAGAAAGTTTTGAAAGTATTAAGGAGAAGCTCAGTAGTAGTCCTGTTTTGAAGCTACCGGATTTTTCAGCTCTATTTGAGGTTGCGTGGATGCTTGTGGACTTGGCATTGGTGGATTTCTAG

Protein sequence

MTKFEERKILFGQKQQESFESIKEKLSSSPVLKLPDFSALFEVAWMLVDLALVDF*

Annotated Terms

The following terms have been associated with this mRNA:

Vocabulary: **INTERPRO**
Term	Definition

GO Annotation

GO Assignments

This mRNA is annotated with the following GO terms.

Category	Term Accession	Term Name
biological_process	GO:0008150	biological_process
cellular_component	GO:0005575	cellular_component
molecular_function	GO:0003674	molecular_function

Relationships

This mRNA is a part of the following gene feature(s):


Feature Name	Unique Name	Type
MELO3C011832	MELO3C011832	gene

The following polypeptide feature(s) derives from this mRNA:


Feature Name	Unique Name	Type
MELO3C011832T1	MELO3C011832T1-protein	polypeptide

The following CDS feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
MELO3C011832T1.cds1	MELO3C011832T1.cds1	CDS

InterPro

Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	unknown	SSF56672	DNA/RNA polymerases	coord: 8..51 score: 2.3