MELO3C011446T1 (mRNA) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGTTTCAGGTTGTTGCGATCAGGGATATCATACCTCCGCCTCTAAGGGAAACATTTAATGATGTTTATATCGCATATGAGCTAATGGATACCGACCTTCATCAAATAATTCGTTCAAACCAAGCATTATCAGAGGAGCATTGTCAGGTTACATTCTGTACATGTGCTTGTTAG ATGGTGTTTCAGGTTGTTGCGATCAGGGATATCATACCTCCGCCTCTAAGGGAAACATTTAATGATGTTTATATCGCATATGAGCTAATGGATACCGACCTTCATCAAATAATTCGTTCAAACCAAGCATTATCAGAGGAGCATTGTCAGGTTACATTCTGTACATGTGCTTGTTAG ATGGTGTTTCAGGTTGTTGCGATCAGGGATATCATACCTCCGCCTCTAAGGGAAACATTTAATGATGTTTATATCGCATATGAGCTAATGGATACCGACCTTCATCAAATAATTCGTTCAAACCAAGCATTATCAGAGGAGCATTGTCAGGTTACATTCTGTACATGTGCTTGTTAG MVFQVVAIRDIIPPPLRETFNDVYIAYELMDTDLHQIIRSNQALSEEHCQVTFCTCAC*
BLAST of MELO3C011446T1 vs. Swiss-Prot
Match: MPK6_ARATH (Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 1.7e-18 Identity = 43/46 (93.48%), Postives = 43/46 (93.48%), Query Frame = 1
BLAST of MELO3C011446T1 vs. Swiss-Prot
Match: MMK1_MEDSA (Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 2.3e-18 Identity = 43/46 (93.48%), Postives = 43/46 (93.48%), Query Frame = 1
BLAST of MELO3C011446T1 vs. Swiss-Prot
Match: MPK_PEA (Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 2.3e-18 Identity = 43/46 (93.48%), Postives = 43/46 (93.48%), Query Frame = 1
BLAST of MELO3C011446T1 vs. Swiss-Prot
Match: NTF4_TOBAC (Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 6.6e-18 Identity = 42/46 (91.30%), Postives = 42/46 (91.30%), Query Frame = 1
BLAST of MELO3C011446T1 vs. Swiss-Prot
Match: MPK1_ORYSJ (Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 6.6e-18 Identity = 42/46 (91.30%), Postives = 43/46 (93.48%), Query Frame = 1
BLAST of MELO3C011446T1 vs. TrEMBL
Match: A0A0A0KIN6_CUCSA (Mitogen-activated protein kinase OS=Cucumis sativus GN=Csa_6G365750 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.0e-17 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 1
BLAST of MELO3C011446T1 vs. TrEMBL
Match: A0A0E0DX52_9ORYZ (Uncharacterized protein OS=Oryza meridionalis PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.3e-17 Identity = 44/52 (84.62%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of MELO3C011446T1 vs. TrEMBL
Match: W9S488_9ROSA (Mitogen-activated protein kinase OS=Morus notabilis GN=L484_020377 PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 2.3e-17 Identity = 45/47 (95.74%), Postives = 46/47 (97.87%), Query Frame = 1
BLAST of MELO3C011446T1 vs. TrEMBL
Match: M0SW93_MUSAM (Mitogen-activated protein kinase OS=Musa acuminata subsp. malaccensis PE=3 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.0e-17 Identity = 44/46 (95.65%), Postives = 46/46 (100.00%), Query Frame = 1
BLAST of MELO3C011446T1 vs. TrEMBL
Match: A0A067DWI5_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0221321mg PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 3.9e-17 Identity = 45/47 (95.74%), Postives = 46/47 (97.87%), Query Frame = 1
BLAST of MELO3C011446T1 vs. TAIR10
Match: AT2G43790.1 (AT2G43790.1 MAP kinase 6) HSP 1 Score: 92.4 bits (228), Expect = 9.8e-20 Identity = 43/46 (93.48%), Postives = 43/46 (93.48%), Query Frame = 1
BLAST of MELO3C011446T1 vs. TAIR10
Match: AT3G45640.1 (AT3G45640.1 mitogen-activated protein kinase 3) HSP 1 Score: 83.2 bits (204), Expect = 5.9e-17 Identity = 36/46 (78.26%), Postives = 42/46 (91.30%), Query Frame = 1
BLAST of MELO3C011446T1 vs. TAIR10
Match: AT4G01370.1 (AT4G01370.1 MAP kinase 4) HSP 1 Score: 79.0 bits (193), Expect = 1.1e-15 Identity = 34/46 (73.91%), Postives = 39/46 (84.78%), Query Frame = 1
BLAST of MELO3C011446T1 vs. TAIR10
Match: AT4G11330.1 (AT4G11330.1 MAP kinase 5) HSP 1 Score: 73.6 bits (179), Expect = 4.7e-14 Identity = 33/46 (71.74%), Postives = 38/46 (82.61%), Query Frame = 1
BLAST of MELO3C011446T1 vs. TAIR10
Match: AT1G07880.2 (AT1G07880.2 Protein kinase superfamily protein) HSP 1 Score: 68.9 bits (167), Expect = 1.2e-12 Identity = 31/46 (67.39%), Postives = 35/46 (76.09%), Query Frame = 1
BLAST of MELO3C011446T1 vs. NCBI nr
Match: gi|702505901|ref|XP_010039661.1| (PREDICTED: uncharacterized protein LOC104428359 [Eucalyptus grandis]) HSP 1 Score: 97.8 bits (242), Expect = 6.6e-18 Identity = 46/50 (92.00%), Postives = 47/50 (94.00%), Query Frame = 1
BLAST of MELO3C011446T1 vs. NCBI nr
Match: gi|659089396|ref|XP_008445484.1| (PREDICTED: mitogen-activated protein kinase homolog D5 isoform X2 [Cucumis melo]) HSP 1 Score: 97.1 bits (240), Expect = 1.1e-17 Identity = 47/50 (94.00%), Postives = 47/50 (94.00%), Query Frame = 1
BLAST of MELO3C011446T1 vs. NCBI nr
Match: gi|449452881|ref|XP_004144187.1| (PREDICTED: mitogen-activated protein kinase homolog MMK1 [Cucumis sativus]) HSP 1 Score: 96.7 bits (239), Expect = 1.5e-17 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 1
BLAST of MELO3C011446T1 vs. NCBI nr
Match: gi|659089394|ref|XP_008445483.1| (PREDICTED: mitogen-activated protein kinase homolog MMK1 isoform X1 [Cucumis melo]) HSP 1 Score: 96.7 bits (239), Expect = 1.5e-17 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 1
BLAST of MELO3C011446T1 vs. NCBI nr
Match: gi|703117367|ref|XP_010101362.1| (Mitogen-activated protein kinase-MMK1-like protein [Morus notabilis]) HSP 1 Score: 95.5 bits (236), Expect = 3.3e-17 Identity = 45/47 (95.74%), Postives = 46/47 (97.87%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
|