MELO3C011446 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACGACGGAGGAGCTTCTCAGCCGGACGACACCGTCATGTCGGAGGCGGCGTCTGTACCTCCACCGCAGCATGACCCGGCGGCGCAACAGCAACATCAACATCAGCCGCCGTCGATGGGGATGGAAAATATTCCGGCGACTTTGAGCCATGGAGGGAGATTTATTCAGTATAATATATTTGGTAACATCTTTGAAGTTACGGCCAAGTACAAGCCTCCTATTATGCCTATTGGCAAAGGCGCTTACGGCATCGTCTGGTCTATGCGATCCCTTTTTAAGTTTTTTTTCATATTCTCTGGAGTTCTATTGTTTTCGTTGTGTATTTTGTTTGTTGTTGTTGATTTGGGGAGTTTGATTTGTTTCAGTTCTGCTCTCAACTCTGAGACGAACGAGCATGTGGCGATTAAGAAGATTGCTAATGCGTTTGATAACAAGATCGATGCCAAGAGAACTCTTCGTGAGATCAAGCTTCTTCGGCATATGGATCATGAAAACGTCAGTGAGTGA ATGGACGACGGAGGAGCTTCTCAGCCGGACGACACCGTCATGTCGGAGGCGGCGTCTGTACCTCCACCGCAGCATGACCCGGCGGCGCAACAGCAACATCAACATCAGCCGCCGTCGATGGGGATGGAAAATATTCCGGCGACTTTGAGCCATGGAGGGAGATTTATTCAGTATAATATATTTGGTAACATCTTTGAAGTTACGGCCAAGTACAAGCCTCCTATTATGCCTATTGGCAAAGGCGCTTACGGCATCGTCTGTTCTGCTCTCAACTCTGAGACGAACGAGCATGTGGCGATTAAGAAGATTGCTAATGCGTTTGATAACAAGATCGATGCCAAGAGAACTCTTCGTGAGATCAAGCTTCTTCGGCATATGGATCATGAAAACGTCAGTGAGTGA ATGGACGACGGAGGAGCTTCTCAGCCGGACGACACCGTCATGTCGGAGGCGGCGTCTGTACCTCCACCGCAGCATGACCCGGCGGCGCAACAGCAACATCAACATCAGCCGCCGTCGATGGGGATGGAAAATATTCCGGCGACTTTGAGCCATGGAGGGAGATTTATTCAGTATAATATATTTGGTAACATCTTTGAAGTTACGGCCAAGTACAAGCCTCCTATTATGCCTATTGGCAAAGGCGCTTACGGCATCGTCTGTTCTGCTCTCAACTCTGAGACGAACGAGCATGTGGCGATTAAGAAGATTGCTAATGCGTTTGATAACAAGATCGATGCCAAGAGAACTCTTCGTGAGATCAAGCTTCTTCGGCATATGGATCATGAAAACGTCAGTGAGTGA MDDGGASQPDDTVMSEAASVPPPQHDPAAQQQHQHQPPSMGMENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENVSE*
BLAST of MELO3C011446 vs. Swiss-Prot
Match: MMK1_MEDSA (Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1) HSP 1 Score: 198.7 bits (504), Expect = 3.9e-50 Identity = 102/129 (79.07%), Postives = 105/129 (81.40%), Query Frame = 1
BLAST of MELO3C011446 vs. Swiss-Prot
Match: MPK_PEA (Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 1.5e-49 Identity = 99/131 (75.57%), Postives = 105/131 (80.15%), Query Frame = 1
BLAST of MELO3C011446 vs. Swiss-Prot
Match: NTF4_TOBAC (Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1) HSP 1 Score: 194.9 bits (494), Expect = 5.6e-49 Identity = 103/129 (79.84%), Postives = 106/129 (82.17%), Query Frame = 1
BLAST of MELO3C011446 vs. Swiss-Prot
Match: MPK6_ARATH (Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1) HSP 1 Score: 191.8 bits (486), Expect = 4.8e-48 Identity = 102/130 (78.46%), Postives = 105/130 (80.77%), Query Frame = 1
BLAST of MELO3C011446 vs. Swiss-Prot
Match: MPK1_ORYSJ (Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 1.0e-45 Identity = 98/129 (75.97%), Postives = 101/129 (78.29%), Query Frame = 1
BLAST of MELO3C011446 vs. TrEMBL
Match: A0A0A0KIN6_CUCSA (Mitogen-activated protein kinase OS=Cucumis sativus GN=Csa_6G365750 PE=3 SV=1) HSP 1 Score: 272.3 bits (695), Expect = 3.1e-70 Identity = 131/131 (100.00%), Postives = 131/131 (100.00%), Query Frame = 1
BLAST of MELO3C011446 vs. TrEMBL
Match: A0A061EQM1_THECC (Mitogen-activated protein kinase 6 OS=Theobroma cacao GN=TCM_019832 PE=3 SV=1) HSP 1 Score: 215.7 bits (548), Expect = 3.4e-53 Identity = 107/131 (81.68%), Postives = 112/131 (85.50%), Query Frame = 1
BLAST of MELO3C011446 vs. TrEMBL
Match: A0A059BE39_EUCGR (Mitogen-activated protein kinase OS=Eucalyptus grandis GN=EUGRSUZ_G01599 PE=3 SV=1) HSP 1 Score: 215.3 bits (547), Expect = 4.5e-53 Identity = 110/129 (85.27%), Postives = 111/129 (86.05%), Query Frame = 1
BLAST of MELO3C011446 vs. TrEMBL
Match: A0A059BCT8_EUCGR (Mitogen-activated protein kinase OS=Eucalyptus grandis GN=EUGRSUZ_G01599 PE=3 SV=1) HSP 1 Score: 215.3 bits (547), Expect = 4.5e-53 Identity = 110/129 (85.27%), Postives = 111/129 (86.05%), Query Frame = 1
BLAST of MELO3C011446 vs. TrEMBL
Match: W9S488_9ROSA (Mitogen-activated protein kinase OS=Morus notabilis GN=L484_020377 PE=3 SV=1) HSP 1 Score: 213.8 bits (543), Expect = 1.3e-52 Identity = 111/134 (82.84%), Postives = 116/134 (86.57%), Query Frame = 1
BLAST of MELO3C011446 vs. TAIR10
Match: AT2G43790.1 (AT2G43790.1 MAP kinase 6) HSP 1 Score: 191.8 bits (486), Expect = 2.7e-49 Identity = 102/130 (78.46%), Postives = 105/130 (80.77%), Query Frame = 1
BLAST of MELO3C011446 vs. TAIR10
Match: AT3G45640.1 (AT3G45640.1 mitogen-activated protein kinase 3) HSP 1 Score: 144.1 bits (362), Expect = 6.4e-35 Identity = 64/88 (72.73%), Postives = 79/88 (89.77%), Query Frame = 1
BLAST of MELO3C011446 vs. TAIR10
Match: AT3G59790.1 (AT3G59790.1 MAP kinase 10) HSP 1 Score: 143.3 bits (360), Expect = 1.1e-34 Identity = 67/88 (76.14%), Postives = 75/88 (85.23%), Query Frame = 1
BLAST of MELO3C011446 vs. TAIR10
Match: AT4G11330.1 (AT4G11330.1 MAP kinase 5) HSP 1 Score: 141.4 bits (355), Expect = 4.2e-34 Identity = 63/92 (68.48%), Postives = 76/92 (82.61%), Query Frame = 1
BLAST of MELO3C011446 vs. TAIR10
Match: AT4G01370.1 (AT4G01370.1 MAP kinase 4) HSP 1 Score: 138.3 bits (347), Expect = 3.5e-33 Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
BLAST of MELO3C011446 vs. NCBI nr
Match: gi|449452881|ref|XP_004144187.1| (PREDICTED: mitogen-activated protein kinase homolog MMK1 [Cucumis sativus]) HSP 1 Score: 272.3 bits (695), Expect = 4.4e-70 Identity = 131/131 (100.00%), Postives = 131/131 (100.00%), Query Frame = 1
BLAST of MELO3C011446 vs. NCBI nr
Match: gi|659089394|ref|XP_008445483.1| (PREDICTED: mitogen-activated protein kinase homolog MMK1 isoform X1 [Cucumis melo]) HSP 1 Score: 272.3 bits (695), Expect = 4.4e-70 Identity = 131/131 (100.00%), Postives = 131/131 (100.00%), Query Frame = 1
BLAST of MELO3C011446 vs. NCBI nr
Match: gi|1009112713|ref|XP_015869828.1| (PREDICTED: mitogen-activated protein kinase homolog MMK1 [Ziziphus jujuba]) HSP 1 Score: 218.4 bits (555), Expect = 7.6e-54 Identity = 108/129 (83.72%), Postives = 114/129 (88.37%), Query Frame = 1
BLAST of MELO3C011446 vs. NCBI nr
Match: gi|590654407|ref|XP_007033688.1| (Mitogen-activated protein kinase 6 [Theobroma cacao]) HSP 1 Score: 215.7 bits (548), Expect = 4.9e-53 Identity = 107/131 (81.68%), Postives = 112/131 (85.50%), Query Frame = 1
BLAST of MELO3C011446 vs. NCBI nr
Match: gi|702397345|ref|XP_010066116.1| (PREDICTED: mitogen-activated protein kinase homolog MMK1 [Eucalyptus grandis]) HSP 1 Score: 215.3 bits (547), Expect = 6.5e-53 Identity = 110/129 (85.27%), Postives = 111/129 (86.05%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|