MELO3C009064T1 (mRNA) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAATGAAGAACTTTGCCTGTGCCGCCTTCATCGCTGTTGTCGCCTCCCTGAGCATGGTTTTGGCCTCTGATGAAGCAGCATCCCCCGCTCCCGGCCCATCCAGCGGTGTTTCCGCTACTTTGCCCGTCGTCGGGACATTGCTAGGTGCATCTGCTGCCTCTCTCATTGCTTACTGCCTTCAGTAA ATGGAAATGAAGAACTTTGCCTGTGCCGCCTTCATCGCTGTTGTCGCCTCCCTGAGCATGGTTTTGGCCTCTGATGAAGCAGCATCCCCCGCTCCCGGCCCATCCAGCGGTGTTTCCGCTACTTTGCCCGTCGTCGGGACATTGCTAGGTGCATCTGCTGCCTCTCTCATTGCTTACTGCCTTCAGTAA ATGGAAATGAAGAACTTTGCCTGTGCCGCCTTCATCGCTGTTGTCGCCTCCCTGAGCATGGTTTTGGCCTCTGATGAAGCAGCATCCCCCGCTCCCGGCCCATCCAGCGGTGTTTCCGCTACTTTGCCCGTCGTCGGGACATTGCTAGGTGCATCTGCTGCCTCTCTCATTGCTTACTGCCTTCAGTAA MEMKNFACAAFIAVVASLSMVLASDEAASPAPGPSSGVSATLPVVGTLLGASAASLIAYCLQ*
BLAST of MELO3C009064T1 vs. Swiss-Prot
Match: AGP23_ARATH (Arabinogalactan peptide 23 OS=Arabidopsis thaliana GN=AGP23 PE=2 SV=2) HSP 1 Score: 63.5 bits (153), Expect = 9.2e-10 Identity = 31/61 (50.82%), Postives = 41/61 (67.21%), Query Frame = 1
BLAST of MELO3C009064T1 vs. Swiss-Prot
Match: AGP40_ARATH (Probable arabinogalactan protein 40 OS=Arabidopsis thaliana GN=AGP40 PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 6.2e-06 Identity = 26/62 (41.94%), Postives = 37/62 (59.68%), Query Frame = 1
BLAST of MELO3C009064T1 vs. TrEMBL
Match: A0A059DIY4_EUCGR (Uncharacterized protein (Fragment) OS=Eucalyptus grandis GN=EUGRSUZ_A02403 PE=4 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 9.9e-11 Identity = 37/62 (59.68%), Postives = 46/62 (74.19%), Query Frame = 1
BLAST of MELO3C009064T1 vs. TrEMBL
Match: U5G938_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0006s05490g PE=4 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 8.4e-10 Identity = 35/61 (57.38%), Postives = 45/61 (73.77%), Query Frame = 1
BLAST of MELO3C009064T1 vs. TrEMBL
Match: B9HNM7_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0009s06810g PE=4 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 5.5e-09 Identity = 38/62 (61.29%), Postives = 46/62 (74.19%), Query Frame = 1
BLAST of MELO3C009064T1 vs. TrEMBL
Match: F6HL55_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_08s0007g07980 PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 7.1e-09 Identity = 34/61 (55.74%), Postives = 43/61 (70.49%), Query Frame = 1
BLAST of MELO3C009064T1 vs. TrEMBL
Match: B9II47_POPTR (Uncharacterized protein (Fragment) OS=Populus trichocarpa GN=POPTR_0016s05250g PE=4 SV=2) HSP 1 Score: 67.0 bits (162), Expect = 9.3e-09 Identity = 33/62 (53.23%), Postives = 43/62 (69.35%), Query Frame = 1
BLAST of MELO3C009064T1 vs. TAIR10
Match: AT3G57690.1 (AT3G57690.1 arabinogalactan protein 23) HSP 1 Score: 63.5 bits (153), Expect = 5.2e-11 Identity = 31/61 (50.82%), Postives = 41/61 (67.21%), Query Frame = 1
BLAST of MELO3C009064T1 vs. TAIR10
Match: AT2G41905.1 (AT2G41905.1 BEST Arabidopsis thaliana protein match is: arabinogalactan protein 23 (TAIR:AT3G57690.1)) HSP 1 Score: 53.9 bits (128), Expect = 4.1e-08 Identity = 31/62 (50.00%), Postives = 40/62 (64.52%), Query Frame = 1
BLAST of MELO3C009064T1 vs. TAIR10
Match: AT3G20865.1 (AT3G20865.1 arabinogalactan protein 40) HSP 1 Score: 50.8 bits (120), Expect = 3.5e-07 Identity = 26/62 (41.94%), Postives = 37/62 (59.68%), Query Frame = 1
BLAST of MELO3C009064T1 vs. NCBI nr
Match: gi|629125825|gb|KCW90250.1| (hypothetical protein EUGRSUZ_A02403, partial [Eucalyptus grandis]) HSP 1 Score: 73.6 bits (179), Expect = 1.4e-10 Identity = 37/62 (59.68%), Postives = 46/62 (74.19%), Query Frame = 1
BLAST of MELO3C009064T1 vs. NCBI nr
Match: gi|566174626|ref|XP_006381024.1| (hypothetical protein POPTR_0006s05490g [Populus trichocarpa]) HSP 1 Score: 70.5 bits (171), Expect = 1.2e-09 Identity = 35/61 (57.38%), Postives = 45/61 (73.77%), Query Frame = 1
BLAST of MELO3C009064T1 vs. NCBI nr
Match: gi|224106059|ref|XP_002314029.1| (hypothetical protein POPTR_0009s06810g [Populus trichocarpa]) HSP 1 Score: 67.8 bits (164), Expect = 7.8e-09 Identity = 38/62 (61.29%), Postives = 46/62 (74.19%), Query Frame = 1
BLAST of MELO3C009064T1 vs. NCBI nr
Match: gi|566208812|ref|XP_002323305.2| (hypothetical protein POPTR_0016s05250g, partial [Populus trichocarpa]) HSP 1 Score: 67.0 bits (162), Expect = 1.3e-08 Identity = 33/62 (53.23%), Postives = 43/62 (69.35%), Query Frame = 1
BLAST of MELO3C009064T1 vs. NCBI nr
Match: gi|703130749|ref|XP_010104709.1| (hypothetical protein L484_000818 [Morus notabilis]) HSP 1 Score: 66.2 bits (160), Expect = 2.3e-08 Identity = 33/61 (54.10%), Postives = 43/61 (70.49%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
|