MELO3C008570.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGCCTCCGCCGTTGAAAAAACCCTTACCGGCATCAGAAACCTAATTCGTCTCCTCCCCACCGGCACCGTCTTTCTTTTCCAATTCCTCAGTCCAATCCTCACCAACAGCGGCTACCGCGAACCAATCAACAAAAAAGGCAGAGAGATAAAGAAGAAGAACAAAACGTTGTACTCGTTCTTCCTTGGGCGAAAGAAAATAGTGTAG ATGGCTGCCTCCGCCGTTGAAAAAACCCTTACCGGCATCAGAAACCTAATTCGTCTCCTCCCCACCGGCACCGTCTTTCTTTTCCAATTCCTCAGTCCAATCCTCACCAACAGCGGCTACCGCGAACCAATCAACAAAAAAGGCAGAGAGATAAAGAAGAAGAACAAAACGTTGTACTCGTTCTTCCTTGGGCGAAAGAAAATAGTGTAG ATGGCTGCCTCCGCCGTTGAAAAAACCCTTACCGGCATCAGAAACCTAATTCGTCTCCTCCCCACCGGCACCGTCTTTCTTTTCCAATTCCTCAGTCCAATCCTCACCAACAGCGGCTACCGCGAACCAATCAACAAAAAAGGCAGAGAGATAAAGAAGAAGAACAAAACGTTGTACTCGTTCTTCCTTGGGCGAAAGAAAATAGTGTAG MAASAVEKTLTGIRNLIRLLPTGTVFLFQFLSPILTNSGYREPINKKGREIKKKNKTLYSFFLGRKKIV
BLAST of MELO3C008570.2.1 vs. NCBI nr
Match: XP_022954144.1 (protein DMP2-like [Cucurbita moschata]) HSP 1 Score: 81.6 bits (200), Expect = 1.1e-12 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. NCBI nr
Match: XP_022973688.1 (protein DMP2-like [Cucurbita maxima]) HSP 1 Score: 81.6 bits (200), Expect = 1.1e-12 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. NCBI nr
Match: XP_022975703.1 (protein DMP2-like [Cucurbita maxima]) HSP 1 Score: 81.6 bits (200), Expect = 1.1e-12 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. NCBI nr
Match: XP_023539190.1 (protein DMP2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 81.6 bits (200), Expect = 1.1e-12 Identity = 41/46 (89.13%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. NCBI nr
Match: XP_008438763.1 (PREDICTED: uncharacterized protein LOC103483776 [Cucumis melo]) HSP 1 Score: 81.3 bits (199), Expect = 1.5e-12 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. TAIR10
Match: AT3G21550.1 (DUF679 domain membrane protein 2) HSP 1 Score: 56.2 bits (134), Expect = 9.1e-09 Identity = 25/40 (62.50%), Postives = 35/40 (87.50%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. TAIR10
Match: AT3G21520.1 (DUF679 domain membrane protein 1) HSP 1 Score: 47.8 bits (112), Expect = 3.2e-06 Identity = 21/39 (53.85%), Postives = 30/39 (76.92%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. TAIR10
Match: AT5G46090.1 (Protein of unknown function (DUF679)) HSP 1 Score: 42.7 bits (99), Expect = 1.0e-04 Identity = 22/39 (56.41%), Postives = 23/39 (58.97%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. TAIR10
Match: AT3G02430.1 (Protein of unknown function (DUF679)) HSP 1 Score: 42.4 bits (98), Expect = 1.4e-04 Identity = 19/39 (48.72%), Postives = 26/39 (66.67%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. TAIR10
Match: AT4G18425.1 (Protein of unknown function (DUF679)) HSP 1 Score: 39.7 bits (91), Expect = 8.8e-04 Identity = 19/42 (45.24%), Postives = 26/42 (61.90%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. Swiss-Prot
Match: sp|Q9LVF1|DMP2_ARATH (Protein DMP2 OS=Arabidopsis thaliana OX=3702 GN=DMP2 PE=2 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 1.6e-07 Identity = 25/40 (62.50%), Postives = 35/40 (87.50%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. Swiss-Prot
Match: sp|Q9LVF4|DMP1_ARATH (Protein DMP1 OS=Arabidopsis thaliana OX=3702 GN=DMP1 PE=2 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 5.8e-05 Identity = 21/39 (53.85%), Postives = 30/39 (76.92%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. TrEMBL
Match: tr|A0A1S3AXU6|A0A1S3AXU6_CUCME (uncharacterized protein LOC103483776 OS=Cucumis melo OX=3656 GN=LOC103483776 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 9.6e-13 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. TrEMBL
Match: tr|A0A0A0LAH2|A0A0A0LAH2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G150800 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.8e-11 Identity = 38/46 (82.61%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. TrEMBL
Match: tr|A0A0A0L536|A0A0A0L536_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G150790 PE=4 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 2.5e-08 Identity = 33/47 (70.21%), Postives = 40/47 (85.11%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. TrEMBL
Match: tr|A0A1S3AZA4|A0A1S3AZA4_CUCME (uncharacterized protein LOC103484187 OS=Cucumis melo OX=3656 GN=LOC103484187 PE=4 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 3.2e-08 Identity = 32/47 (68.09%), Postives = 40/47 (85.11%), Query Frame = 0
BLAST of MELO3C008570.2.1 vs. TrEMBL
Match: tr|A0A0A0L7S6|A0A0A0L7S6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G150780 PE=4 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 7.1e-08 Identity = 32/46 (69.57%), Postives = 37/46 (80.43%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|