MELO3C006458T3 (mRNA) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGAAGATCAATCTGCTCCAAGTAAGTTCATCCTATCAAAACGATCTTCATTTTTGAGAAACTAGTTTCGATTGAATGGTTTGTAAACTAACATGAATTTGATCAACTATCGCAAGTGTGATAGTCTTGGAAGTCAAATCAATTCACAGAAAACCAACTATCACAAGTATTTTATGTTCTGTAGGATTTAACTTTATTCATATTGAAGTTTTGTATATTTTGAGTCTGTCAGAGTATACACTTTGAATGGATTTAAGTTAATATCTATGGCAAAATTTAACATAAATATATAATTTTTAAATAGGAAAAACTCAATGGCCAGAGCTTGTCTTCATAAAATATTCTATTGCTGCCGCGATCATAGAAAGAGAGAATCCTGATGTGGAAGCTGTCAAGATTCTATCTGGTACACCTAGAATTCTGAATTTTGATACCAAACGAGTTTGGTGTGATGTCAATGTGGAAGATGTAATTGTGAAAATGCCCAAAGTTGGTTAG ATGGCTGAAGATCAATCTGCTCCAAGAAAAACTCAATGGCCAGAGCTTGTCTTCATAAAATATTCTATTGCTGCCGCGATCATAGAAAGAGAGAATCCTGATGTGGAAGCTGTCAAGATTCTATCTGGTACACCTAGAATTCTGAATTTTGATACCAAACGAGTTTGGTGTGATGTCAATGTGGAAGATGTAATTGTGAAAATGCCCAAAGTTGGTTAG ATGGCTGAAGATCAATCTGCTCCAAGAAAAACTCAATGGCCAGAGCTTGTCTTCATAAAATATTCTATTGCTGCCGCGATCATAGAAAGAGAGAATCCTGATGTGGAAGCTGTCAAGATTCTATCTGGTACACCTAGAATTCTGAATTTTGATACCAAACGAGTTTGGTGTGATGTCAATGTGGAAGATGTAATTGTGAAAATGCCCAAAGTTGGTTAG MAEDQSAPRKTQWPELVFIKYSIAAAIIERENPDVEAVKILSGTPRILNFDTKRVWCDVNVEDVIVKMPKVG*
BLAST of MELO3C006458T3 vs. Swiss-Prot
Match: ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima PE=1 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 2.6e-08 Identity = 30/67 (44.78%), Postives = 40/67 (59.70%), Query Frame = 1
BLAST of MELO3C006458T3 vs. TrEMBL
Match: A0A0A0L8E6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142910 PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 5.7e-26 Identity = 57/69 (82.61%), Postives = 65/69 (94.20%), Query Frame = 1
BLAST of MELO3C006458T3 vs. TrEMBL
Match: A0A0A0L785_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G141900 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.7e-17 Identity = 42/69 (60.87%), Postives = 55/69 (79.71%), Query Frame = 1
BLAST of MELO3C006458T3 vs. TrEMBL
Match: A0A0A0L9Z4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142410 PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 4.7e-12 Identity = 37/70 (52.86%), Postives = 50/70 (71.43%), Query Frame = 1
BLAST of MELO3C006458T3 vs. TrEMBL
Match: A0A0A0L4I0_CUCSA (Protease inhibitor protein OS=Cucumis sativus GN=Csa_3G142400 PE=4 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.2e-10 Identity = 36/69 (52.17%), Postives = 47/69 (68.12%), Query Frame = 1
BLAST of MELO3C006458T3 vs. TrEMBL
Match: W9S0M9_9ROSA (Proteinase inhibitor OS=Morus notabilis GN=L484_005748 PE=4 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.8e-08 Identity = 36/72 (50.00%), Postives = 45/72 (62.50%), Query Frame = 1
BLAST of MELO3C006458T3 vs. TAIR10
Match: AT2G38870.1 (AT2G38870.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 57.0 bits (136), Expect = 5.6e-09 Identity = 30/65 (46.15%), Postives = 34/65 (52.31%), Query Frame = 1
BLAST of MELO3C006458T3 vs. TAIR10
Match: AT5G43580.1 (AT5G43580.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 50.1 bits (118), Expect = 6.9e-07 Identity = 30/72 (41.67%), Postives = 39/72 (54.17%), Query Frame = 1
BLAST of MELO3C006458T3 vs. NCBI nr
Match: gi|700201764|gb|KGN56897.1| (hypothetical protein Csa_3G142910 [Cucumis sativus]) HSP 1 Score: 124.4 bits (311), Expect = 8.2e-26 Identity = 57/69 (82.61%), Postives = 65/69 (94.20%), Query Frame = 1
BLAST of MELO3C006458T3 vs. NCBI nr
Match: gi|700201761|gb|KGN56894.1| (hypothetical protein Csa_3G141900 [Cucumis sativus]) HSP 1 Score: 95.1 bits (235), Expect = 5.3e-17 Identity = 42/69 (60.87%), Postives = 55/69 (79.71%), Query Frame = 1
BLAST of MELO3C006458T3 vs. NCBI nr
Match: gi|700201763|gb|KGN56896.1| (hypothetical protein Csa_3G142410 [Cucumis sativus]) HSP 1 Score: 78.2 bits (191), Expect = 6.7e-12 Identity = 37/70 (52.86%), Postives = 50/70 (71.43%), Query Frame = 1
BLAST of MELO3C006458T3 vs. NCBI nr
Match: gi|700201762|gb|KGN56895.1| (Protease inhibitor protein [Cucumis sativus]) HSP 1 Score: 73.6 bits (179), Expect = 1.7e-10 Identity = 36/69 (52.17%), Postives = 47/69 (68.12%), Query Frame = 1
BLAST of MELO3C006458T3 vs. NCBI nr
Match: gi|720071522|ref|XP_010278088.1| (PREDICTED: inhibitor of trypsin and hageman factor-like [Nelumbo nucifera]) HSP 1 Score: 69.3 bits (168), Expect = 3.1e-09 Identity = 32/63 (50.79%), Postives = 42/63 (66.67%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
|