MELO3C004738.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCGGACACGACTTGGAATTGGAGAGAGCTCGATTGTTAAGCTTGGCAGCGAAACTCGGTTTCGATGAAGAATCGGCTGAGGCTTGCTTGGACCGCATAATCAACCTATATGGTAATTTCTTCCATTTCCACCCCATTCCAGACCCTAAAATTGCACTTTCAGTTTCATCTATATAA ATGGGCGGACACGACTTGGAATTGGAGAGAGCTCGATTGTTAAGCTTGGCAGCGAAACTCGGTTTCGATGAAGAATCGGCTGAGGCTTGCTTGGACCGCATAATCAACCTATATGGTAATTTCTTCCATTTCCACCCCATTCCAGACCCTAAAATTGCACTTTCAGTTTCATCTATATAA ATGGGCGGACACGACTTGGAATTGGAGAGAGCTCGATTGTTAAGCTTGGCAGCGAAACTCGGTTTCGATGAAGAATCGGCTGAGGCTTGCTTGGACCGCATAATCAACCTATATGGTAATTTCTTCCATTTCCACCCCATTCCAGACCCTAAAATTGCACTTTCAGTTTCATCTATATAA MGGHDLELERARLLSLAAKLGFDEESAEACLDRIINLYGNFFHFHPIPDPKIALSVSSI
BLAST of MELO3C004738.2.1 vs. NCBI nr
Match: XP_008453778.1 (PREDICTED: ATP-dependent DNA helicase Q-like 1 [Cucumis melo]) HSP 1 Score: 79.0 bits (193), Expect = 6.2e-12 Identity = 37/40 (92.50%), Postives = 40/40 (100.00%), Query Frame = 0
BLAST of MELO3C004738.2.1 vs. NCBI nr
Match: XP_022999189.1 (ATP-dependent DNA helicase Q-like 1 [Cucurbita maxima]) HSP 1 Score: 79.0 bits (193), Expect = 6.2e-12 Identity = 37/40 (92.50%), Postives = 40/40 (100.00%), Query Frame = 0
BLAST of MELO3C004738.2.1 vs. NCBI nr
Match: XP_011648853.1 (PREDICTED: ATP-dependent DNA helicase Q-like 1 [Cucumis sativus] >KGN60981.1 hypothetical protein Csa_2G033360 [Cucumis sativus]) HSP 1 Score: 77.8 bits (190), Expect = 1.4e-11 Identity = 36/40 (90.00%), Postives = 40/40 (100.00%), Query Frame = 0
BLAST of MELO3C004738.2.1 vs. NCBI nr
Match: XP_022946040.1 (ATP-dependent DNA helicase Q-like 1 [Cucurbita moschata]) HSP 1 Score: 77.0 bits (188), Expect = 2.3e-11 Identity = 36/40 (90.00%), Postives = 40/40 (100.00%), Query Frame = 0
BLAST of MELO3C004738.2.1 vs. NCBI nr
Match: XP_023545259.1 (ATP-dependent DNA helicase Q-like 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 76.3 bits (186), Expect = 4.0e-11 Identity = 36/40 (90.00%), Postives = 39/40 (97.50%), Query Frame = 0
BLAST of MELO3C004738.2.1 vs. TAIR10
Match: AT3G05740.1 (RECQ helicase l1) HSP 1 Score: 59.3 bits (142), Expect = 9.2e-10 Identity = 26/40 (65.00%), Postives = 33/40 (82.50%), Query Frame = 0
BLAST of MELO3C004738.2.1 vs. Swiss-Prot
Match: sp|Q9FT74|RQL1_ARATH (ATP-dependent DNA helicase Q-like 1 OS=Arabidopsis thaliana OX=3702 GN=RECQL1 PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 1.7e-08 Identity = 26/40 (65.00%), Postives = 33/40 (82.50%), Query Frame = 0
BLAST of MELO3C004738.2.1 vs. TrEMBL
Match: tr|A0A1S3BX65|A0A1S3BX65_CUCME (ATP-dependent DNA helicase OS=Cucumis melo OX=3656 GN=LOC103494405 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 4.1e-12 Identity = 37/40 (92.50%), Postives = 40/40 (100.00%), Query Frame = 0
BLAST of MELO3C004738.2.1 vs. TrEMBL
Match: tr|A0A0A0LLZ4|A0A0A0LLZ4_CUCSA (ATP-dependent DNA helicase OS=Cucumis sativus OX=3659 GN=Csa_2G033360 PE=3 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 9.1e-12 Identity = 36/40 (90.00%), Postives = 40/40 (100.00%), Query Frame = 0
BLAST of MELO3C004738.2.1 vs. TrEMBL
Match: tr|A0A2P6R7G6|A0A2P6R7G6_ROSCH (ATP-dependent DNA helicase OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr3g0456831 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 2.7e-08 Identity = 29/39 (74.36%), Postives = 34/39 (87.18%), Query Frame = 0
BLAST of MELO3C004738.2.1 vs. TrEMBL
Match: tr|A0A2K2AAE4|A0A2K2AAE4_POPTR (ATP-dependent DNA helicase OS=Populus trichocarpa OX=3694 GN=POPTR_005G019800v3 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 4.7e-08 Identity = 30/40 (75.00%), Postives = 34/40 (85.00%), Query Frame = 0
BLAST of MELO3C004738.2.1 vs. TrEMBL
Match: tr|A0A2K2AAC3|A0A2K2AAC3_POPTR (ATP-dependent DNA helicase OS=Populus trichocarpa OX=3694 GN=POPTR_005G019800v3 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 4.7e-08 Identity = 30/40 (75.00%), Postives = 34/40 (85.00%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|