MELO3C004701.2.1 (mRNA) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCGTTGTTGAGCGATTTTGGTTGCAATATCCCGGCACCGGAGGCTCATCCAGCAAGTCAGTTTTTAGCGGAATGGTTCGAGGCACGTGGGGTGTCGCCCGGGAATGGGCTTAGGCTATGTTCGCACGTGGGGTGTGGACGTCCGGAGACGAGACGACATGAGTTCCGTCGGTGTTCCGTTTGTGGTGCTGTTAATTACTGCTCACGTGCGTGTCAGGCTCTTGATTGGAAACTCCGCCATAAGATGGATTGTGCGCCGGTGGAACGATGGCTCAATGACAATGGTGACGGTGGGGACGATGTAG ATGTCCGTTGTTGAGCGATTTTGGTTGCAATATCCCGGCACCGGAGGCTCATCCAGCAAGTCAGTTTTTAGCGGAATGGTTCGAGGCACGTGGGGTGTCGCCCGGGAATGGGCTTAGGCTATGTTCGCACGTGGGGTGTGGACGTCCGGAGACGAGACGACATGAGTTCCGTCGGTGTTCCGTTTGTGGTGCTGTTAATTACTGCTCACGTGCGTGTCAGGCTCTTGATTGGAAACTCCGCCATAAGATGGATTGTGCGCCGGTGGAACGATGGCTCAATGACAATGGTGACGGTGGGGACGATGTAG TGTCCGTTGTTGAGCGATTTTGGTTGCAATATCCCGGCACCGGAGGCTCATCCAGCAAGTCAGTTTTTAGCGGAATGGTTCGAGGCACGTGGGGTGTCGCCCGGGAATGGGCTTAGGCTATGTTCGCACGTGGGGTGTGGACGTCCGGAGACGAGACGACATGAGTTCCGTCGGTGTTCCGTTTGTGGTGCTGTTAATTACTGCTCACGTGCGTGTCAGGCTCTTGATTGGAAACTCCGCCATAAGATGGATTGTGCGCCGGTGGAACGATGGCTCAATGACAATGGTGACGGTGGGGACGATGTA CPLLSDFGCNIPAPEAHPASQFLAEWFEARGVSPGNGLRLCSHVGCGRPETRRHEFRRCSVCGAVNYCSRACQALDWKLRHKMDCAPVERWLNDNGDGGDDV
BLAST of MELO3C004701.2.1 vs. NCBI nr
Match: XP_004135325.1 (PREDICTED: F-box protein At1g67340 [Cucumis sativus] >KGN51672.1 hypothetical protein Csa_5G589890 [Cucumis sativus]) HSP 1 Score: 223.8 bits (569), Expect = 2.7e-55 Identity = 98/102 (96.08%), Postives = 100/102 (98.04%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. NCBI nr
Match: XP_008446037.1 (PREDICTED: F-box protein At1g67340 [Cucumis melo]) HSP 1 Score: 223.0 bits (567), Expect = 4.6e-55 Identity = 98/102 (96.08%), Postives = 99/102 (97.06%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. NCBI nr
Match: XP_022998094.1 (F-box protein At1g67340 [Cucurbita maxima]) HSP 1 Score: 218.0 bits (554), Expect = 1.5e-53 Identity = 95/101 (94.06%), Postives = 97/101 (96.04%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. NCBI nr
Match: XP_023516587.1 (F-box protein At1g67340-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 218.0 bits (554), Expect = 1.5e-53 Identity = 95/101 (94.06%), Postives = 97/101 (96.04%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. NCBI nr
Match: XP_022957417.1 (F-box protein At1g67340 [Cucurbita moschata]) HSP 1 Score: 216.5 bits (550), Expect = 4.3e-53 Identity = 94/101 (93.07%), Postives = 96/101 (95.05%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. TAIR10
Match: AT1G67340.1 (HCP-like superfamily protein with MYND-type zinc finger) HSP 1 Score: 191.4 bits (485), Expect = 2.7e-49 Identity = 82/101 (81.19%), Postives = 91/101 (90.10%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. TAIR10
Match: AT5G50450.1 (HCP-like superfamily protein with MYND-type zinc finger) HSP 1 Score: 134.4 bits (337), Expect = 3.9e-32 Identity = 54/91 (59.34%), Postives = 67/91 (73.63%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. TAIR10
Match: AT1G17110.2 (ubiquitin-specific protease 15) HSP 1 Score: 47.4 bits (111), Expect = 6.2e-06 Identity = 17/32 (53.12%), Postives = 22/32 (68.75%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. TAIR10
Match: AT2G24640.1 (ubiquitin-specific protease 19) HSP 1 Score: 45.8 bits (107), Expect = 1.8e-05 Identity = 19/40 (47.50%), Postives = 24/40 (60.00%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. TAIR10
Match: AT4G02220.1 (zinc finger (MYND type) family protein / programmed cell death 2 C-terminal domain-containing protein) HSP 1 Score: 45.1 bits (105), Expect = 3.1e-05 Identity = 28/93 (30.11%), Postives = 42/93 (45.16%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. Swiss-Prot
Match: sp|Q9FYF9|FB76_ARATH (F-box protein At1g67340 OS=Arabidopsis thaliana OX=3702 GN=At1g67340 PE=1 SV=1) HSP 1 Score: 191.4 bits (485), Expect = 4.8e-48 Identity = 82/101 (81.19%), Postives = 91/101 (90.10%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. Swiss-Prot
Match: sp|Q9FK27|FB342_ARATH (F-box protein At5g50450 OS=Arabidopsis thaliana OX=3702 GN=At5g50450 PE=2 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 7.0e-31 Identity = 54/91 (59.34%), Postives = 67/91 (73.63%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. Swiss-Prot
Match: sp|Q2YDC9|PDCD2_BOVIN (Programmed cell death protein 2 OS=Bos taurus OX=9913 GN=PDCD2 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 2.3e-05 Identity = 22/54 (40.74%), Postives = 29/54 (53.70%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. Swiss-Prot
Match: sp|Q9FPS9|UBP15_ARATH (Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=2) HSP 1 Score: 47.4 bits (111), Expect = 1.1e-04 Identity = 17/32 (53.12%), Postives = 22/32 (68.75%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. Swiss-Prot
Match: sp|Q09415|SET14_CAEEL (SET domain-containing protein 14 OS=Caenorhabditis elegans OX=6239 GN=set-14 PE=4 SV=2) HSP 1 Score: 46.2 bits (108), Expect = 2.5e-04 Identity = 18/44 (40.91%), Postives = 27/44 (61.36%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. TrEMBL
Match: tr|A0A0A0KTC5|A0A0A0KTC5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G589890 PE=4 SV=1) HSP 1 Score: 223.8 bits (569), Expect = 1.8e-55 Identity = 98/102 (96.08%), Postives = 100/102 (98.04%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. TrEMBL
Match: tr|A0A1S3BE37|A0A1S3BE37_CUCME (F-box protein At1g67340 OS=Cucumis melo OX=3656 GN=LOC103488887 PE=4 SV=1) HSP 1 Score: 223.0 bits (567), Expect = 3.0e-55 Identity = 98/102 (96.08%), Postives = 99/102 (97.06%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. TrEMBL
Match: tr|A0A2P5BPE9|A0A2P5BPE9_PARAD (Eukaryotic elongation factor 2 kinase OS=Parasponia andersonii OX=3476 GN=PanWU01x14_221980 PE=4 SV=1) HSP 1 Score: 207.6 bits (527), Expect = 1.3e-50 Identity = 87/98 (88.78%), Postives = 95/98 (96.94%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. TrEMBL
Match: tr|A0A2P5EBD3|A0A2P5EBD3_9ROSA (Eukaryotic elongation factor 2 kinase OS=Trema orientalis OX=63057 GN=TorRG33x02_214350 PE=4 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 3.8e-50 Identity = 87/98 (88.78%), Postives = 94/98 (95.92%), Query Frame = 0
BLAST of MELO3C004701.2.1 vs. TrEMBL
Match: tr|A0A061E5E1|A0A061E5E1_THECC (HCP-like superfamily protein with MYND-type zinc finger OS=Theobroma cacao OX=3641 GN=TCM_008826 PE=4 SV=1) HSP 1 Score: 205.7 bits (522), Expect = 5.0e-50 Identity = 87/100 (87.00%), Postives = 94/100 (94.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following five_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
|