MELO3C003031T1 (mRNA) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAAACAAATTCAATCAACCTCCAACAATGAAGAGCTTAGTAAAATGAAGCCATCCAATATACAATCTACGCAAGATTTGATGGACTTTGTGAACGAAAAGAAGAGTAAACGGTTCAAGGTAAGTCAATGTGGCCATTTGTTTAAAAAGACACACATAAGTACAATTTATGTTTGATGATTATCCCATTTGTGTTTGATTAGGCTGAAAGTGCAAAGTTCAAATCTATGAAGAAGAGGAAACTTCCACATACATGTAGCCGTAAAGGTTATGCTCGACTGGCGGAAGATATGGTATTCATTATTCTAAAGTAA ATGGTGAAACAAATTCAATCAACCTCCAACAATGAAGAGCTTAGTAAAATGAAGCCATCCAATATACAATCTACGCAAGATTTGATGGACTTTGTGAACGAAAAGAAGAGTAAACGGTTCAAGGCTGAAAGTGCAAAGTTCAAATCTATGAAGAAGAGGAAACTTCCACATACATGTAGCCGTAAAGGTTATGCTCGACTGGCGGAAGATATGGTATTCATTATTCTAAAGTAA ATGGTGAAACAAATTCAATCAACCTCCAACAATGAAGAGCTTAGTAAAATGAAGCCATCCAATATACAATCTACGCAAGATTTGATGGACTTTGTGAACGAAAAGAAGAGTAAACGGTTCAAGGCTGAAAGTGCAAAGTTCAAATCTATGAAGAAGAGGAAACTTCCACATACATGTAGCCGTAAAGGTTATGCTCGACTGGCGGAAGATATGGTATTCATTATTCTAAAGTAA MVKQIQSTSNNEELSKMKPSNIQSTQDLMDFVNEKKSKRFKAESAKFKSMKKRKLPHTCSRKGYARLAEDMVFIILK*
BLAST of MELO3C003031T1 vs. TrEMBL
Match: A0A0A0L5I2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G113900 PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 4.1e-22 Identity = 55/71 (77.46%), Postives = 60/71 (84.51%), Query Frame = 1
BLAST of MELO3C003031T1 vs. TrEMBL
Match: A0A0A0L5I2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G113900 PE=4 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.6e-05 Identity = 30/53 (56.60%), Postives = 35/53 (66.04%), Query Frame = 1
HSP 2 Score: 37.0 bits (84), Expect = 1.3e+01 Identity = 19/31 (61.29%), Postives = 24/31 (77.42%), Query Frame = 1
HSP 3 Score: 79.3 bits (194), Expect = 2.2e-12 Identity = 36/71 (50.70%), Postives = 50/71 (70.42%), Query Frame = 1
BLAST of MELO3C003031T1 vs. TrEMBL
Match: Q9C6V0_ARATH (En/Spm-like transposon protein, putative OS=Arabidopsis thaliana GN=F27M3_21 PE=4 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.3e-06 Identity = 31/70 (44.29%), Postives = 41/70 (58.57%), Query Frame = 1
BLAST of MELO3C003031T1 vs. NCBI nr
Match: gi|700201166|gb|KGN56299.1| (hypothetical protein Csa_3G113900 [Cucumis sativus]) HSP 1 Score: 111.7 bits (278), Expect = 5.8e-22 Identity = 55/71 (77.46%), Postives = 60/71 (84.51%), Query Frame = 1
BLAST of MELO3C003031T1 vs. NCBI nr
Match: gi|700201166|gb|KGN56299.1| (hypothetical protein Csa_3G113900 [Cucumis sativus]) HSP 1 Score: 56.6 bits (135), Expect = 2.2e-05 Identity = 30/53 (56.60%), Postives = 35/53 (66.04%), Query Frame = 1
HSP 2 Score: 37.0 bits (84), Expect = 1.8e+01 Identity = 19/31 (61.29%), Postives = 24/31 (77.42%), Query Frame = 1
HSP 3 Score: 111.7 bits (278), Expect = 5.8e-22 Identity = 55/71 (77.46%), Postives = 60/71 (84.51%), Query Frame = 1
BLAST of MELO3C003031T1 vs. NCBI nr
Match: gi|778676496|ref|XP_011650597.1| (PREDICTED: uncharacterized protein LOC101217008 isoform X7 [Cucumis sativus]) HSP 1 Score: 109.0 bits (271), Expect = 3.8e-21 Identity = 53/72 (73.61%), Postives = 62/72 (86.11%), Query Frame = 1
HSP 2 Score: 93.2 bits (230), Expect = 2.2e-16 Identity = 49/71 (69.01%), Postives = 56/71 (78.87%), Query Frame = 1
HSP 3 Score: 111.7 bits (278), Expect = 5.8e-22 Identity = 55/71 (77.46%), Postives = 60/71 (84.51%), Query Frame = 1
BLAST of MELO3C003031T1 vs. NCBI nr
Match: gi|778676478|ref|XP_011650589.1| (PREDICTED: uncharacterized protein LOC101217008 isoform X1 [Cucumis sativus]) HSP 1 Score: 107.8 bits (268), Expect = 8.4e-21 Identity = 53/71 (74.65%), Postives = 61/71 (85.92%), Query Frame = 1
HSP 2 Score: 93.2 bits (230), Expect = 2.2e-16 Identity = 49/71 (69.01%), Postives = 56/71 (78.87%), Query Frame = 1
HSP 3 Score: 111.7 bits (278), Expect = 5.8e-22 Identity = 55/71 (77.46%), Postives = 60/71 (84.51%), Query Frame = 1
BLAST of MELO3C003031T1 vs. NCBI nr
Match: gi|778676482|ref|XP_011650591.1| (PREDICTED: uncharacterized protein LOC101217008 isoform X2 [Cucumis sativus]) HSP 1 Score: 107.8 bits (268), Expect = 8.4e-21 Identity = 53/71 (74.65%), Postives = 61/71 (85.92%), Query Frame = 1
HSP 2 Score: 93.2 bits (230), Expect = 2.2e-16 Identity = 49/71 (69.01%), Postives = 56/71 (78.87%), Query Frame = 1
HSP 3 Score: 111.7 bits (278), Expect = 5.8e-22 Identity = 55/71 (77.46%), Postives = 60/71 (84.51%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
|