Lsi05G021190.1 (mRNA) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGGCCCTAGCCTTCGTCGCCGTGTTCACATGCTCCCTGATGGTCGTTCTGTCTCAGAATGAGGACGTAGAAAGTTGTGTACCGGTGGCGCAGGAGCTATCACCATGTTTGGGCTTCATCAAAGGCAGCGACAGCGCGTTTGGTGGTGAAAATCCATCGCCGTCGTGCTGCAGCGGCGTTAAAAAGTTAGCGGGCGATGCTAAAACGAAGAAAGATAAGGTTGCTCTGTGCGAATGCATCAAGAAGACTTTGTCGATGATCGGACCTTATGATTCGAGTCGCATCCCTTTGATTCCAAAAGAATGTGGAATTCCCGTCCAAATCCCTCCCATCGACAATTCCACTGATTGCTCATCGTAA ATGGGGGCCCTAGCCTTCGTCGCCGTGTTCACATGCTCCCTGATGGTCGTTCTGTCTCAGAATGAGGACGTAGAAAGTTGTGTACCGGTGGCGCAGGAGCTATCACCATGTTTGGGCTTCATCAAAGGCAGCGACAGCGCGTTTGGTGGTGAAAATCCATCGCCGTCGTGCTGCAGCGGCGTTAAAAAGTTAGCGGGCGATGCTAAAACGAAGAAAGATAAGGTTGCTCTGTGCGAATGCATCAAGAAGACTTTGTCGATGATCGGACCTTATGATTCGAGTCGCATCCCTTTGATTCCAAAAGAATGTGGAATTCCCGTCCAAATCCCTCCCATCGACAATTCCACTGATTGCTCATCGTAA ATGGGGGCCCTAGCCTTCGTCGCCGTGTTCACATGCTCCCTGATGGTCGTTCTGTCTCAGAATGAGGACGTAGAAAGTTGTGTACCGGTGGCGCAGGAGCTATCACCATGTTTGGGCTTCATCAAAGGCAGCGACAGCGCGTTTGGTGGTGAAAATCCATCGCCGTCGTGCTGCAGCGGCGTTAAAAAGTTAGCGGGCGATGCTAAAACGAAGAAAGATAAGGTTGCTCTGTGCGAATGCATCAAGAAGACTTTGTCGATGATCGGACCTTATGATTCGAGTCGCATCCCTTTGATTCCAAAAGAATGTGGAATTCCCGTCCAAATCCCTCCCATCGACAATTCCACTGATTGCTCATCGTAA MGALAFVAVFTCSLMVVLSQNEDVESCVPVAQELSPCLGFIKGSDSAFGGENPSPSCCSGVKKLAGDAKTKKDKVALCECIKKTLSMIGPYDSSRIPLIPKECGIPVQIPPIDNSTDCSS
BLAST of Lsi05G021190.1 vs. Swiss-Prot
Match: NLTP6_AMBAR (Non-specific lipid-transfer protein OS=Ambrosia artemisiifolia PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.4e-14 Identity = 38/94 (40.43%), Postives = 53/94 (56.38%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. Swiss-Prot
Match: NLT12_PARJU (Probable non-specific lipid-transfer protein 1 OS=Parietaria judaica PE=1 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.5e-13 Identity = 37/97 (38.14%), Postives = 54/97 (55.67%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. Swiss-Prot
Match: NLT11_PARJU (Probable non-specific lipid-transfer protein (Fragment) OS=Parietaria judaica GN=PMAI PE=1 SV=3) HSP 1 Score: 76.3 bits (186), Expect = 2.6e-13 Identity = 36/97 (37.11%), Postives = 54/97 (55.67%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. Swiss-Prot
Match: NLT21_PARJU (Probable non-specific lipid-transfer protein 2 OS=Parietaria judaica PE=1 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 2.6e-13 Identity = 36/95 (37.89%), Postives = 52/95 (54.74%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. Swiss-Prot
Match: NLT13_PARJU (Probable non-specific lipid-transfer protein 1 OS=Parietaria judaica PE=1 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 7.6e-13 Identity = 43/119 (36.13%), Postives = 62/119 (52.10%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. TrEMBL
Match: A0A0A0L5X1_CUCSA (Non-specific lipid-transfer protein OS=Cucumis sativus GN=Csa_3G119620 PE=3 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 1.3e-43 Identity = 91/117 (77.78%), Postives = 101/117 (86.32%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. TrEMBL
Match: A0A061DSH8_THECC (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein, putative OS=Theobroma cacao GN=TCM_005159 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 5.3e-21 Identity = 49/116 (42.24%), Postives = 73/116 (62.93%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. TrEMBL
Match: I1JRZ7_SOYBN (Non-specific lipid-transfer protein OS=Glycine max GN=GLYMA_03G257200 PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 2.0e-20 Identity = 43/95 (45.26%), Postives = 69/95 (72.63%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. TrEMBL
Match: A0A0B2RU93_GLYSO (Non-specific lipid-transfer protein OS=Glycine soja GN=glysoja_029007 PE=3 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.6e-20 Identity = 43/94 (45.74%), Postives = 68/94 (72.34%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. TrEMBL
Match: M5XSP9_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa023612mg PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.7e-19 Identity = 45/110 (40.91%), Postives = 71/110 (64.55%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. TAIR10
Match: AT5G59310.1 (AT5G59310.1 lipid transfer protein 4) HSP 1 Score: 67.4 bits (163), Expect = 6.9e-12 Identity = 42/118 (35.59%), Postives = 64/118 (54.24%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. TAIR10
Match: AT2G15050.1 (AT2G15050.1 lipid transfer protein) HSP 1 Score: 57.8 bits (138), Expect = 5.4e-09 Identity = 36/108 (33.33%), Postives = 50/108 (46.30%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. TAIR10
Match: AT2G38540.1 (AT2G38540.1 lipid transfer protein 1) HSP 1 Score: 55.8 bits (133), Expect = 2.1e-08 Identity = 38/97 (39.18%), Postives = 50/97 (51.55%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. TAIR10
Match: AT2G18370.1 (AT2G18370.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 54.3 bits (129), Expect = 6.0e-08 Identity = 36/119 (30.25%), Postives = 54/119 (45.38%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. TAIR10
Match: AT5G01870.1 (AT5G01870.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 51.6 bits (122), Expect = 3.9e-07 Identity = 35/104 (33.65%), Postives = 54/104 (51.92%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. NCBI nr
Match: gi|659074983|ref|XP_008437901.1| (PREDICTED: non-specific lipid-transfer protein 3-like [Cucumis melo]) HSP 1 Score: 186.0 bits (471), Expect = 3.8e-44 Identity = 93/117 (79.49%), Postives = 102/117 (87.18%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. NCBI nr
Match: gi|700201296|gb|KGN56429.1| (hypothetical protein Csa_3G119620 [Cucumis sativus]) HSP 1 Score: 183.7 bits (465), Expect = 1.9e-43 Identity = 91/117 (77.78%), Postives = 101/117 (86.32%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. NCBI nr
Match: gi|778676915|ref|XP_004134304.2| (PREDICTED: non-specific lipid-transfer protein Cw18-like [Cucumis sativus]) HSP 1 Score: 183.7 bits (465), Expect = 1.9e-43 Identity = 91/117 (77.78%), Postives = 101/117 (86.32%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. NCBI nr
Match: gi|470141935|ref|XP_004306679.1| (PREDICTED: probable non-specific lipid-transfer protein 2 [Fragaria vesca subsp. vesca]) HSP 1 Score: 112.5 bits (280), Expect = 5.3e-22 Identity = 50/107 (46.73%), Postives = 75/107 (70.09%), Query Frame = 1
BLAST of Lsi05G021190.1 vs. NCBI nr
Match: gi|590721283|ref|XP_007051567.1| (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein, putative [Theobroma cacao]) HSP 1 Score: 108.6 bits (270), Expect = 7.6e-21 Identity = 49/116 (42.24%), Postives = 73/116 (62.93%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
|