Lsi05G013670.1 (mRNA) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCTTTACAATCTTGCTTTCTTCTCCTTCTCTTTCTCCTCCTTCTCCAACATCTTTGTCTCGTTCGAGCTTCATCGGCGCATTCTTGCAATGGCTCCATAGCCGAGTGTGGTAGCGAGGAAGAGATACTGATGGAGTCGGAGATAAGTCGAAGGTTTCTCGAACAACAAAAGAAATACATCTCCATTGGAGCTTTGAAGAAGGATCATCCAGCTTGCGATGGTGGTGGCAGCGGCCAACCTTACACCAAAAGCGGAAGCTGCTCTCCGCCACAAACTAATCCTTACAATCGAGGCTGCTCTAAGATATATCGTTGTAGGTCGGATGATTGA ATGCCTTTACAATCTTGCTTTCTTCTCCTTCTCTTTCTCCTCCTTCTCCAACATCTTTGTCTCGTTCGAGCTTCATCGGCGCATTCTTGCAATGGCTCCATAGCCGAGTGTGGTAGCGAGGAAGAGATACTGATGGAGTCGGAGATAAGTCGAAGGTTTCTCGAACAACAAAAGAAATACATCTCCATTGGAGCTTTGAAGAAGGATCATCCAGCTTGCGATGGTGGTGGCAGCGGCCAACCTTACACCAAAAGCGGAAGCTGCTCTCCGCCACAAACTAATCCTTACAATCGAGGCTGCTCTAAGATATATCGTTGTAGGTCGGATGATTGA ATGCCTTTACAATCTTGCTTTCTTCTCCTTCTCTTTCTCCTCCTTCTCCAACATCTTTGTCTCGTTCGAGCTTCATCGGCGCATTCTTGCAATGGCTCCATAGCCGAGTGTGGTAGCGAGGAAGAGATACTGATGGAGTCGGAGATAAGTCGAAGGTTTCTCGAACAACAAAAGAAATACATCTCCATTGGAGCTTTGAAGAAGGATCATCCAGCTTGCGATGGTGGTGGCAGCGGCCAACCTTACACCAAAAGCGGAAGCTGCTCTCCGCCACAAACTAATCCTTACAATCGAGGCTGCTCTAAGATATATCGTTGTAGGTCGGATGATTGA MPLQSCFLLLLFLLLLQHLCLVRASSAHSCNGSIAECGSEEEILMESEISRRFLEQQKKYISIGALKKDHPACDGGGSGQPYTKSGSCSPPQTNPYNRGCSKIYRCRSDD
BLAST of Lsi05G013670.1 vs. Swiss-Prot
Match: RLF32_ARATH (Protein RALF-like 32 OS=Arabidopsis thaliana GN=RALFL32 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.6e-17 Identity = 51/107 (47.66%), Postives = 67/107 (62.62%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. Swiss-Prot
Match: RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum GN=RALF PE=1 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 6.5e-11 Identity = 42/86 (48.84%), Postives = 50/86 (58.14%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. Swiss-Prot
Match: RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana GN=RALF1 PE=1 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.9e-10 Identity = 39/79 (49.37%), Postives = 50/79 (63.29%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. Swiss-Prot
Match: RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana GN=RALFL33 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.2e-10 Identity = 39/81 (48.15%), Postives = 50/81 (61.73%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. Swiss-Prot
Match: RLF24_ARATH (Protein RALF-like 24 OS=Arabidopsis thaliana GN=RALFL24 PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 2.2e-06 Identity = 46/115 (40.00%), Postives = 57/115 (49.57%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. TrEMBL
Match: A0A0A0L9A8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G171840 PE=4 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 7.0e-44 Identity = 92/112 (82.14%), Postives = 98/112 (87.50%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. TrEMBL
Match: A0A0A0L624_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G171850 PE=4 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 2.6e-30 Identity = 78/101 (77.23%), Postives = 82/101 (81.19%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. TrEMBL
Match: A0A0S3R1D3_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.01G214200 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.3e-26 Identity = 65/107 (60.75%), Postives = 82/107 (76.64%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. TrEMBL
Match: C6T1A5_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_05G151400 PE=2 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.7e-26 Identity = 62/103 (60.19%), Postives = 76/103 (73.79%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. TrEMBL
Match: A0A151SJC7_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_001065 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.7e-26 Identity = 59/85 (69.41%), Postives = 71/85 (83.53%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. TAIR10
Match: AT4G14010.1 (AT4G14010.1 ralf-like 32) HSP 1 Score: 90.1 bits (222), Expect = 9.1e-19 Identity = 51/107 (47.66%), Postives = 67/107 (62.62%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. TAIR10
Match: AT1G02900.1 (AT1G02900.1 rapid alkalinization factor 1) HSP 1 Score: 66.6 bits (161), Expect = 1.1e-11 Identity = 39/79 (49.37%), Postives = 50/79 (63.29%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. TAIR10
Match: AT4G15800.1 (AT4G15800.1 ralf-like 33) HSP 1 Score: 65.9 bits (159), Expect = 1.8e-11 Identity = 39/81 (48.15%), Postives = 50/81 (61.73%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. TAIR10
Match: AT3G23805.1 (AT3G23805.1 ralf-like 24) HSP 1 Score: 53.1 bits (126), Expect = 1.2e-07 Identity = 46/115 (40.00%), Postives = 57/115 (49.57%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. TAIR10
Match: AT4G13950.1 (AT4G13950.1 ralf-like 31) HSP 1 Score: 51.6 bits (122), Expect = 3.6e-07 Identity = 30/70 (42.86%), Postives = 38/70 (54.29%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. NCBI nr
Match: gi|659077106|ref|XP_008439036.1| (PREDICTED: protein RALF-like 32 [Cucumis melo]) HSP 1 Score: 186.0 bits (471), Expect = 3.4e-44 Identity = 94/111 (84.68%), Postives = 98/111 (88.29%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. NCBI nr
Match: gi|778679218|ref|XP_004147646.2| (PREDICTED: protein RALF-like 32 [Cucumis sativus]) HSP 1 Score: 184.5 bits (467), Expect = 1.0e-43 Identity = 92/112 (82.14%), Postives = 98/112 (87.50%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. NCBI nr
Match: gi|700202095|gb|KGN57228.1| (hypothetical protein Csa_3G171850 [Cucumis sativus]) HSP 1 Score: 139.4 bits (350), Expect = 3.7e-30 Identity = 78/101 (77.23%), Postives = 82/101 (81.19%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. NCBI nr
Match: gi|951070903|ref|XP_014490978.1| (PREDICTED: protein RALF-like 32 [Vigna radiata var. radiata]) HSP 1 Score: 127.1 bits (318), Expect = 1.9e-26 Identity = 66/110 (60.00%), Postives = 83/110 (75.45%), Query Frame = 1
BLAST of Lsi05G013670.1 vs. NCBI nr
Match: gi|965658049|dbj|BAT74468.1| (hypothetical protein VIGAN_01214200 [Vigna angularis var. angularis]) HSP 1 Score: 127.1 bits (318), Expect = 1.9e-26 Identity = 65/107 (60.75%), Postives = 82/107 (76.64%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
|