Cucsa.239270.1 (mRNA) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGGATGTTTGGATTTGGATCTAATGATGAGACAGGCACTCAAATTCCAACCCAAGCCCAATCGATTGTGGAAGGATCAGGATCCGTTATGGTTTCTGAGTTCAAACCAGTTCCTGATGTTGATTATCTACAG ATGCGGATGTTTGGATTTGGATCTAATGATGAGACAGGCACTCAAATTCCAACCCAAGCCCAATCGATTGTGGAAGGATCAGGATCCGTTATGGTTTCTGAGTTCAAACCAGTTCCTGATGTTGATTATCTACAG ATGCGGATGTTTGGATTTGGATCTAATGATGAGACAGGCACTCAAATTCCAACCCAAGCCCAATCGATTGTGGAAGGATCAGGATCCGTTATGGTTTCTGAGTTCAAACCAGTTCCTGATGTTGATTATCTACAG MRMFGFGSNDETGTQIPTQAQSIVEGSGSVMVSEFKPVPDVDYLQ
BLAST of Cucsa.239270.1 vs. TrEMBL
Match: A0A0A0K8V7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G232500 PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 6.6e-17 Identity = 45/45 (100.00%), Postives = 45/45 (100.00%), Query Frame = 1
BLAST of Cucsa.239270.1 vs. TrEMBL
Match: V4SXJ1_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10012405mg PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 2.4e-11 Identity = 34/40 (85.00%), Postives = 39/40 (97.50%), Query Frame = 1
BLAST of Cucsa.239270.1 vs. TrEMBL
Match: A0A067ED30_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0233341mg PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 2.4e-11 Identity = 34/40 (85.00%), Postives = 39/40 (97.50%), Query Frame = 1
BLAST of Cucsa.239270.1 vs. TrEMBL
Match: A0A067EQB0_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g0233341mg PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 2.4e-11 Identity = 34/40 (85.00%), Postives = 39/40 (97.50%), Query Frame = 1
BLAST of Cucsa.239270.1 vs. TrEMBL
Match: V4SMK8_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10012405mg PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 2.4e-11 Identity = 34/40 (85.00%), Postives = 39/40 (97.50%), Query Frame = 1
BLAST of Cucsa.239270.1 vs. TAIR10
Match: AT2G43945.1 (AT2G43945.1 unknown protein) HSP 1 Score: 57.4 bits (137), Expect = 2.7e-09 Identity = 26/38 (68.42%), Postives = 33/38 (86.84%), Query Frame = 1
BLAST of Cucsa.239270.1 vs. TAIR10
Match: AT3G59870.1 (AT3G59870.1 unknown protein) HSP 1 Score: 52.0 bits (123), Expect = 1.1e-07 Identity = 24/34 (70.59%), Postives = 29/34 (85.29%), Query Frame = 1
BLAST of Cucsa.239270.1 vs. NCBI nr
Match: gi|449444096|ref|XP_004139811.1| (PREDICTED: uncharacterized protein LOC101209189 isoform X1 [Cucumis sativus]) HSP 1 Score: 93.6 bits (231), Expect = 9.5e-17 Identity = 45/45 (100.00%), Postives = 45/45 (100.00%), Query Frame = 1
BLAST of Cucsa.239270.1 vs. NCBI nr
Match: gi|778725847|ref|XP_011659013.1| (PREDICTED: uncharacterized protein LOC101209189 isoform X2 [Cucumis sativus]) HSP 1 Score: 93.6 bits (231), Expect = 9.5e-17 Identity = 45/45 (100.00%), Postives = 45/45 (100.00%), Query Frame = 1
BLAST of Cucsa.239270.1 vs. NCBI nr
Match: gi|700188993|gb|KGN44226.1| (hypothetical protein Csa_7G232500 [Cucumis sativus]) HSP 1 Score: 93.6 bits (231), Expect = 9.5e-17 Identity = 45/45 (100.00%), Postives = 45/45 (100.00%), Query Frame = 1
BLAST of Cucsa.239270.1 vs. NCBI nr
Match: gi|659092673|ref|XP_008447166.1| (PREDICTED: uncharacterized protein LOC103489683 isoform X1 [Cucumis melo]) HSP 1 Score: 91.7 bits (226), Expect = 3.6e-16 Identity = 44/44 (100.00%), Postives = 44/44 (100.00%), Query Frame = 1
BLAST of Cucsa.239270.1 vs. NCBI nr
Match: gi|659092675|ref|XP_008447167.1| (PREDICTED: uncharacterized protein LOC103489683 isoform X2 [Cucumis melo]) HSP 1 Score: 89.7 bits (221), Expect = 1.4e-15 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
|