Cucsa.169470.1 (mRNA) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.TCAGGGTTTACCAAAAACCAACTGAATGTTCCAAAAGGCCATGTTGCCGTTTATGTGGGAGAGATTCAAAGGAAGCGCTTTGTGGTTCCGATATCTTACTTAAACGATCCATCGTTCCAGCAACTGCTCAGCCATGCAGAGGAAGAGTTTGGCTTTCATCATCCTCATGGGGGTCTAACTATTCCTTGCAAAGAAGATGCCTTTGTTGATCTCACTTCTAGATTGCAAGTAGCTTGA TCAGGGTTTACCAAAAACCAACTGAATGTTCCAAAAGGCCATGTTGCCGTTTATGTGGGAGAGATTCAAAGGAAGCGCTTTGTGGTTCCGATATCTTACTTAAACGATCCATCGTTCCAGCAACTGCTCAGCCATGCAGAGGAAGAGTTTGGCTTTCATCATCCTCATGGGGGTCTAACTATTCCTTGCAAAGAAGATGCCTTTGTTGATCTCACTTCTAGATTGCAAGTAGCTTGA TCAGGGTTTACCAAAAACCAACTGAATGTTCCAAAAGGCCATGTTGCCGTTTATGTGGGAGAGATTCAAAGGAAGCGCTTTGTGGTTCCGATATCTTACTTAAACGATCCATCGTTCCAGCAACTGCTCAGCCATGCAGAGGAAGAGTTTGGCTTTCATCATCCTCATGGGGGTCTAACTATTCCTTGCAAAGAAGATGCCTTTGTTGATCTCACTTCTAGATTGCAAGTAGCTTGA SGFTKNQLNVPKGHVAVYVGEIQRKRFVVPISYLNDPSFQQLLSHAEEEFGFHHPHGGLTIPCKEDAFVDLTSRLQVA*
BLAST of Cucsa.169470.1 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.2e-22 Identity = 48/66 (72.73%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.7e-22 Identity = 48/66 (72.73%), Postives = 56/66 (84.85%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 3.5e-22 Identity = 47/66 (71.21%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. Swiss-Prot
Match: SAU21_ARATH (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana GN=SAUR21 PE=2 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 5.9e-22 Identity = 47/66 (71.21%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 5.9e-22 Identity = 47/65 (72.31%), Postives = 56/65 (86.15%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. TrEMBL
Match: A0A0A0LPI0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258720 PE=4 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 7.0e-38 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. TrEMBL
Match: A0A0A0LJ99_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258740 PE=4 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 4.3e-35 Identity = 73/78 (93.59%), Postives = 76/78 (97.44%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. TrEMBL
Match: A0A0A0LIZ9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258760 PE=4 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 4.4e-32 Identity = 66/78 (84.62%), Postives = 73/78 (93.59%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. TrEMBL
Match: A0A0A0LJA3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258790 PE=4 SV=1) HSP 1 Score: 143.3 bits (360), Expect = 1.3e-31 Identity = 69/78 (88.46%), Postives = 72/78 (92.31%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. TrEMBL
Match: A0A0A0LLF1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258700 PE=4 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 1.7e-31 Identity = 66/78 (84.62%), Postives = 72/78 (92.31%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 106.7 bits (265), Expect = 6.7e-24 Identity = 48/66 (72.73%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. TAIR10
Match: AT5G18020.1 (AT5G18020.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.5 bits (262), Expect = 1.5e-23 Identity = 48/66 (72.73%), Postives = 56/66 (84.85%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.5 bits (262), Expect = 1.5e-23 Identity = 49/74 (66.22%), Postives = 58/74 (78.38%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. TAIR10
Match: AT5G18050.1 (AT5G18050.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.1 bits (261), Expect = 2.0e-23 Identity = 47/66 (71.21%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. TAIR10
Match: AT5G18030.1 (AT5G18030.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 104.4 bits (259), Expect = 3.3e-23 Identity = 47/66 (71.21%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. NCBI nr
Match: gi|700206757|gb|KGN61876.1| (hypothetical protein Csa_2G258720 [Cucumis sativus]) HSP 1 Score: 164.1 bits (414), Expect = 1.0e-37 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. NCBI nr
Match: gi|659115592|ref|XP_008457632.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 158.3 bits (399), Expect = 5.5e-36 Identity = 75/78 (96.15%), Postives = 77/78 (98.72%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. NCBI nr
Match: gi|778669593|ref|XP_011649273.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 154.8 bits (390), Expect = 6.1e-35 Identity = 73/78 (93.59%), Postives = 76/78 (97.44%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. NCBI nr
Match: gi|659115596|ref|XP_008457635.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 147.9 bits (372), Expect = 7.5e-33 Identity = 70/78 (89.74%), Postives = 74/78 (94.87%), Query Frame = 1
BLAST of Cucsa.169470.1 vs. NCBI nr
Match: gi|700206761|gb|KGN61880.1| (hypothetical protein Csa_2G258760 [Cucumis sativus]) HSP 1 Score: 144.8 bits (364), Expect = 6.3e-32 Identity = 66/78 (84.62%), Postives = 73/78 (93.59%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
|