Cucsa.152790.1 (mRNA) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATAAATACTAAAATATTAATTGATTGCCCACTTTTCCTGTCTTGCAGCATTTGGAAGTGGAGGGGTTACTCTATTCGCTACCAATGTTCGGGAGACGATGGCCCTGCATTGATACTCATTCATGGTTTTGGAGCAAACAG ATGATAAATACTAAAATATTAATTGATTGCCCACTTTTCCTGTCTTGCAGCATTTGGAAGTGGAGGGGTTACTCTATTCGCTACCAATGTTCGGGAGACGATGGCCCTGCATTGATACTCATTCATGGTTTTGGAGCAAACAG ATGATAAATACTAAAATATTAATTGATTGCCCACTTTTCCTGTCTTGCAGCATTTGGAAGTGGAGGGGTTACTCTATTCGCTACCAATGTTCGGGAGACGATGGCCCTGCATTGATACTCATTCATGGTTTTGGAGCAAACAG MINTKILIDCPLFLSCSIWKWRGYSIRYQCSGDDGPALILIHGFGANX
BLAST of Cucsa.152790.1 vs. TrEMBL
Match: A0A0A0KX02_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G269110 PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.2e-10 Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = 1
BLAST of Cucsa.152790.1 vs. TrEMBL
Match: A0A059DA34_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_B03607 PE=4 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 1.6e-08 Identity = 28/40 (70.00%), Postives = 31/40 (77.50%), Query Frame = 1
BLAST of Cucsa.152790.1 vs. TrEMBL
Match: A0A0J8CLE9_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_4g071060 PE=4 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 2.7e-08 Identity = 29/37 (78.38%), Postives = 31/37 (83.78%), Query Frame = 1
BLAST of Cucsa.152790.1 vs. TrEMBL
Match: A0A061GSB2_THECC (Alpha/beta-Hydrolases superfamily protein isoform 2 OS=Theobroma cacao GN=TCM_040028 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.3e-07 Identity = 27/37 (72.97%), Postives = 30/37 (81.08%), Query Frame = 1
BLAST of Cucsa.152790.1 vs. TrEMBL
Match: A0A061GT11_THECC (Alpha/beta-Hydrolases superfamily protein isoform 1 OS=Theobroma cacao GN=TCM_040028 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.3e-07 Identity = 27/37 (72.97%), Postives = 30/37 (81.08%), Query Frame = 1
BLAST of Cucsa.152790.1 vs. TAIR10
Match: AT5G19850.1 (AT5G19850.1 alpha/beta-Hydrolases superfamily protein) HSP 1 Score: 62.0 bits (149), Expect = 1.2e-10 Identity = 23/29 (79.31%), Postives = 27/29 (93.10%), Query Frame = 1
BLAST of Cucsa.152790.1 vs. TAIR10
Match: AT4G25290.1 (AT4G25290.1 DNA photolyases;DNA photolyases) HSP 1 Score: 48.9 bits (115), Expect = 1.0e-06 Identity = 17/29 (58.62%), Postives = 25/29 (86.21%), Query Frame = 1
BLAST of Cucsa.152790.1 vs. NCBI nr
Match: gi|778692786|ref|XP_011653522.1| (PREDICTED: pheophytinase, chloroplastic isoform X2 [Cucumis sativus]) HSP 1 Score: 73.6 bits (179), Expect = 1.1e-10 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1
BLAST of Cucsa.152790.1 vs. NCBI nr
Match: gi|659097917|ref|XP_008449880.1| (PREDICTED: pheophytinase, chloroplastic isoform X2 [Cucumis melo]) HSP 1 Score: 73.2 bits (178), Expect = 1.4e-10 Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = 1
BLAST of Cucsa.152790.1 vs. NCBI nr
Match: gi|449463857|ref|XP_004149647.1| (PREDICTED: pheophytinase, chloroplastic isoform X1 [Cucumis sativus]) HSP 1 Score: 72.0 bits (175), Expect = 3.2e-10 Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = 1
BLAST of Cucsa.152790.1 vs. NCBI nr
Match: gi|700198870|gb|KGN54028.1| (hypothetical protein Csa_4G269110 [Cucumis sativus]) HSP 1 Score: 72.0 bits (175), Expect = 3.2e-10 Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = 1
BLAST of Cucsa.152790.1 vs. NCBI nr
Match: gi|778692789|ref|XP_011653523.1| (PREDICTED: pheophytinase, chloroplastic isoform X3 [Cucumis sativus]) HSP 1 Score: 72.0 bits (175), Expect = 3.2e-10 Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
|