Cucsa.032860.1 (mRNA) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATTAATGTACAAAAAGAATTCAATTCTGGGAACCGAAAACTCAACATTGCTATTACAAGAATAGGAAACCCTTATGGACACCCTAATATTCTCGCAGAATTTATAGCCGGACAATTAAAGAATAGAGTTTCATTTCGCAAACCAATGAAAAAAAGCTATTGA ATTAATGTACAAAAAGAATTCAATTCTGGGAACCGAAAACTCAACATTGCTATTACAAGAATAGGAAACCCTTATGGACACCCTAATATTCTCGCAGAATTTATAGCCGGACAATTAAAGAATAGAGTTTCATTTCGCAAACCAATGAAAAAAAGCTATTGA ATTAATGTACAAAAAGAATTCAATTCTGGGAACCGAAAACTCAACATTGCTATTACAAGAATAGGAAACCCTTATGGACACCCTAATATTCTCGCAGAATTTATAGCCGGACAATTAAAGAATAGAGTTTCATTTCGCAAACCAATGAAAAAAAGCTATTGA INVQKEFNSGNRKLNIAITRIGNPYGHPNILAEFIAGQLKNRVSFRKPMKKSY*
BLAST of Cucsa.032860.1 vs. Swiss-Prot
Match: RR3_CUCSA (30S ribosomal protein S3, chloroplastic OS=Cucumis sativus GN=rps3 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 6.9e-22 Identity = 50/52 (96.15%), Postives = 51/52 (98.08%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. Swiss-Prot
Match: RR3_GOSHI (30S ribosomal protein S3, chloroplastic OS=Gossypium hirsutum GN=rps3 PE=3 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 3.2e-19 Identity = 46/52 (88.46%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. Swiss-Prot
Match: RR3_GOSBA (30S ribosomal protein S3, chloroplastic OS=Gossypium barbadense GN=rps3 PE=3 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 3.2e-19 Identity = 46/52 (88.46%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. Swiss-Prot
Match: RR3_DRANE (30S ribosomal protein S3, chloroplastic OS=Draba nemorosa GN=rps3 PE=3 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 7.1e-19 Identity = 46/52 (88.46%), Postives = 47/52 (90.38%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. Swiss-Prot
Match: RR3_MORIN (30S ribosomal protein S3, chloroplastic OS=Morus indica GN=rps3 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 1.2e-18 Identity = 44/52 (84.62%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. TrEMBL
Match: W8E3G6_9ROSI (Ribosomal protein S3 OS=Cucumis hystrix GN=rps3 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 7.7e-20 Identity = 50/52 (96.15%), Postives = 51/52 (98.08%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. TrEMBL
Match: G3ETT6_CUCME (30S ribosomal protein S3, chloroplastic OS=Cucumis melo subsp. melo GN=rps3 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 8.5e-19 Identity = 48/52 (92.31%), Postives = 50/52 (96.15%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. TrEMBL
Match: X2EYC6_LAGSI (30S ribosomal protein S3, chloroplastic OS=Lagenaria siceraria GN=rps3 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 8.5e-19 Identity = 48/52 (92.31%), Postives = 50/52 (96.15%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. TrEMBL
Match: X2EZ87_LAGSI (30S ribosomal protein S3, chloroplastic OS=Lagenaria siceraria GN=rps3 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 8.5e-19 Identity = 48/52 (92.31%), Postives = 50/52 (96.15%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. TrEMBL
Match: X2F0P5_LAGSI (30S ribosomal protein S3, chloroplastic OS=Lagenaria siceraria GN=rps3 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 8.5e-19 Identity = 48/52 (92.31%), Postives = 50/52 (96.15%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. TAIR10
Match: ATCG00800.1 (ATCG00800.1 structural constituent of ribosome) HSP 1 Score: 89.0 bits (219), Expect = 9.9e-19 Identity = 44/52 (84.62%), Postives = 46/52 (88.46%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. NCBI nr
Match: gi|68164842|ref|YP_247638.1| (ribosomal protein S3 [Cucumis sativus]) HSP 1 Score: 103.6 bits (257), Expect = 1.1e-19 Identity = 50/52 (96.15%), Postives = 51/52 (98.08%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. NCBI nr
Match: gi|595645242|gb|AHM88705.1| (ribosomal protein S3 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 100.1 bits (248), Expect = 1.2e-18 Identity = 48/52 (92.31%), Postives = 50/52 (96.15%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. NCBI nr
Match: gi|346578230|ref|YP_004841822.1| (ribosomal protein S3 [Cucumis melo subsp. melo]) HSP 1 Score: 100.1 bits (248), Expect = 1.2e-18 Identity = 48/52 (92.31%), Postives = 50/52 (96.15%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. NCBI nr
Match: gi|595645478|gb|AHM88937.1| (ribosomal protein S3 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 100.1 bits (248), Expect = 1.2e-18 Identity = 48/52 (92.31%), Postives = 50/52 (96.15%), Query Frame = 1
BLAST of Cucsa.032860.1 vs. NCBI nr
Match: gi|595645302|gb|AHM88764.1| (ribosomal protein S3 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 100.1 bits (248), Expect = 1.2e-18 Identity = 48/52 (92.31%), Postives = 50/52 (96.15%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
|