Cucsa.017520.1 (mRNA) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.TCCTCGACGTAAAGAAGAAGTGTTTAACTATCGACATTCTTCACTGCAAAATGTCATTGAACATTGTTTTATTGTGCTGAAGGTTCAATTTCTTATTATTAAGCAAATGCCTCCATACCCGATCGAGACACAAAAATATATACCGATAGCATGTTACACAATTCACAACTATATTAGATTGAATGATTGTCAAGATGATCTATTCAATGACTAA tcctcgacgtaaagaagaagtgtttaactatcgacattcttcactgcaaaatgtcattgaacattgttttattgtgctgaaggttcaatttcttattattaagcaaatgcctccatacccgatcgagacacaaaaatatataccgatagcatgttacacaattcacaactatattagattgaatgattgtcaagatgatctattcaatgactaa TCCTCGACGTAAAGAAGAAGTGTTTAACTATCGACATTCTTCACTGCAAAATGTCATTGAACATTGTTTTATTGTGCTGAAGGTTCAATTTCTTATTATTAAGCAAATGCCTCCATACCCGATCGAGACACAAAAATATATACCGATAGCATGTTACACAATTCACAACTATATTAGATTGAATGATTGTCAAGATGATCTATTCAATGACTAA PRRKEEVFNYRHSSLQNVIEHCFIVLKVQFLIIKQMPPYPIETQKYIPIACYTIHNYIRLNDCQDDLFND*
BLAST of Cucsa.017520.1 vs. TrEMBL
Match: A0A0B2SJL0_GLYSO (Putative nuclease HARBI1 (Fragment) OS=Glycine soja GN=glysoja_043532 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.5e-15 Identity = 43/68 (63.24%), Postives = 52/68 (76.47%), Query Frame = 1
BLAST of Cucsa.017520.1 vs. TrEMBL
Match: A0A0R0GE91_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_14G172000 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 8.3e-14 Identity = 41/69 (59.42%), Postives = 50/69 (72.46%), Query Frame = 1
BLAST of Cucsa.017520.1 vs. TrEMBL
Match: K7M7K9_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 8.3e-14 Identity = 41/69 (59.42%), Postives = 50/69 (72.46%), Query Frame = 1
BLAST of Cucsa.017520.1 vs. TrEMBL
Match: B9FTH0_ORYSJ (Reticulon-like protein OS=Oryza sativa subsp. japonica GN=OsJ_21474 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 3.5e-12 Identity = 38/68 (55.88%), Postives = 48/68 (70.59%), Query Frame = 1
BLAST of Cucsa.017520.1 vs. TrEMBL
Match: B9FWG5_ORYSJ (Uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_23740 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.3e-11 Identity = 38/68 (55.88%), Postives = 47/68 (69.12%), Query Frame = 1
BLAST of Cucsa.017520.1 vs. TAIR10
Match: AT5G35695.1 (AT5G35695.1 Putative harbinger transposase-derived nuclease (InterPro:IPR006912)) HSP 1 Score: 58.2 bits (139), Expect = 2.5e-09 Identity = 26/66 (39.39%), Postives = 39/66 (59.09%), Query Frame = 1
BLAST of Cucsa.017520.1 vs. TAIR10
Match: AT5G41980.1 (AT5G41980.1 Putative harbinger transposase-derived nuclease (InterPro:IPR006912)) HSP 1 Score: 56.6 bits (135), Expect = 7.2e-09 Identity = 27/64 (42.19%), Postives = 37/64 (57.81%), Query Frame = 1
BLAST of Cucsa.017520.1 vs. NCBI nr
Match: gi|659086645|ref|XP_008444045.1| (PREDICTED: uncharacterized protein LOC103487496 [Cucumis melo]) HSP 1 Score: 124.4 bits (311), Expect = 7.9e-26 Identity = 57/69 (82.61%), Postives = 62/69 (89.86%), Query Frame = 1
BLAST of Cucsa.017520.1 vs. NCBI nr
Match: gi|659111926|ref|XP_008455977.1| (PREDICTED: uncharacterized protein LOC103496041 [Cucumis melo]) HSP 1 Score: 114.0 bits (284), Expect = 1.1e-22 Identity = 54/68 (79.41%), Postives = 58/68 (85.29%), Query Frame = 1
BLAST of Cucsa.017520.1 vs. NCBI nr
Match: gi|734429578|gb|KHN45215.1| (Putative nuclease HARBI1, partial [Glycine soja]) HSP 1 Score: 89.7 bits (221), Expect = 2.2e-15 Identity = 43/68 (63.24%), Postives = 52/68 (76.47%), Query Frame = 1
BLAST of Cucsa.017520.1 vs. NCBI nr
Match: gi|828289035|ref|XP_012570899.1| (PREDICTED: uncharacterized protein LOC105852030 [Cicer arietinum]) HSP 1 Score: 84.3 bits (207), Expect = 9.1e-14 Identity = 42/69 (60.87%), Postives = 49/69 (71.01%), Query Frame = 1
BLAST of Cucsa.017520.1 vs. NCBI nr
Match: gi|828290881|ref|XP_012573888.1| (PREDICTED: uncharacterized protein LOC105852522 [Cicer arietinum]) HSP 1 Score: 84.3 bits (207), Expect = 9.1e-14 Identity = 42/69 (60.87%), Postives = 49/69 (71.01%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
|