CsaV3_4G031450.1 (mRNA) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.AACTTTGCCTGCGCCGCTTTCATCACTGTTGCCGCCTCCCTGAGCATGGTTTTGGCCTCTGATGAAGCAGCGTCCCCAGCACCCGGCCCATCTAGCGCTGCTTCCGCTACTTTGCCAGTCGTCGGGACGTTGCTAGGTGCATCTGCTGCCTCTCTCATTGCTTACTGCCTTCAGTAA AACTTTGCCTGCGCCGCTTTCATCACTGTTGCCGCCTCCCTGAGCATGGTTTTGGCCTCTGATGAAGCAGCGTCCCCAGCACCCGGCCCATCTAGCGCTGCTTCCGCTACTTTGCCAGTCGTCGGGACGTTGCTAGGTGCATCTGCTGCCTCTCTCATTGCTTACTGCCTTCAGTAA AACTTTGCCTGCGCCGCTTTCATCACTGTTGCCGCCTCCCTGAGCATGGTTTTGGCCTCTGATGAAGCAGCGTCCCCAGCACCCGGCCCATCTAGCGCTGCTTCCGCTACTTTGCCAGTCGTCGGGACGTTGCTAGGTGCATCTGCTGCCTCTCTCATTGCTTACTGCCTTCAGTAA NFACAAFITVAASLSMVLASDEAASPAPGPSSAASATLPVVGTLLGASAASLIAYCLQ
BLAST of CsaV3_4G031450.1 vs. NCBI nr
Match: PNT29922.1 (hypothetical protein POPTR_006G056200v3 [Populus trichocarpa]) HSP 1 Score: 57.0 bits (136), Expect = 2.5e-05 Identity = 33/53 (62.26%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of CsaV3_4G031450.1 vs. NCBI nr
Match: PON58107.1 (hypothetical protein PanWU01x14_168770 [Parasponia andersonii]) HSP 1 Score: 56.2 bits (134), Expect = 4.3e-05 Identity = 34/52 (65.38%), Postives = 40/52 (76.92%), Query Frame = 0
BLAST of CsaV3_4G031450.1 vs. NCBI nr
Match: PON91671.1 (hypothetical protein TorRG33x02_125020 [Trema orientalis]) HSP 1 Score: 56.2 bits (134), Expect = 4.3e-05 Identity = 34/52 (65.38%), Postives = 40/52 (76.92%), Query Frame = 0
BLAST of CsaV3_4G031450.1 vs. NCBI nr
Match: PNS97963.1 (hypothetical protein POPTR_016G052000v3 [Populus trichocarpa]) HSP 1 Score: 55.8 bits (133), Expect = 5.6e-05 Identity = 32/53 (60.38%), Postives = 40/53 (75.47%), Query Frame = 0
BLAST of CsaV3_4G031450.1 vs. NCBI nr
Match: OVA12266.1 (hypothetical protein BVC80_1779g40 [Macleaya cordata]) HSP 1 Score: 54.7 bits (130), Expect = 1.2e-04 Identity = 30/56 (53.57%), Postives = 42/56 (75.00%), Query Frame = 0
BLAST of CsaV3_4G031450.1 vs. TAIR10
Match: AT3G57690.1 (arabinogalactan protein 23) HSP 1 Score: 47.8 bits (112), Expect = 2.8e-06 Identity = 29/55 (52.73%), Postives = 41/55 (74.55%), Query Frame = 0
BLAST of CsaV3_4G031450.1 vs. Swiss-Prot
Match: sp|Q8S2W4|AGP23_ARATH (Arabinogalactan protein 23 OS=Arabidopsis thaliana OX=3702 GN=AGP23 PE=1 SV=2) HSP 1 Score: 47.8 bits (112), Expect = 5.0e-05 Identity = 29/55 (52.73%), Postives = 41/55 (74.55%), Query Frame = 0
BLAST of CsaV3_4G031450.1 vs. TrEMBL
Match: tr|A0A2K1ZXB0|A0A2K1ZXB0_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_006G056200v3 PE=4 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.7e-05 Identity = 33/53 (62.26%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of CsaV3_4G031450.1 vs. TrEMBL
Match: tr|A0A2P5F1L3|A0A2P5F1L3_9ROSA (Uncharacterized protein OS=Trema orientalis OX=63057 GN=TorRG33x02_125020 PE=4 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.8e-05 Identity = 34/52 (65.38%), Postives = 40/52 (76.92%), Query Frame = 0
BLAST of CsaV3_4G031450.1 vs. TrEMBL
Match: tr|A0A2P5CAP7|A0A2P5CAP7_PARAD (Uncharacterized protein OS=Parasponia andersonii OX=3476 GN=PanWU01x14_168770 PE=4 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.8e-05 Identity = 34/52 (65.38%), Postives = 40/52 (76.92%), Query Frame = 0
BLAST of CsaV3_4G031450.1 vs. TrEMBL
Match: tr|A0A2K1XB13|A0A2K1XB13_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_016G052000v3 PE=4 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.7e-05 Identity = 32/53 (60.38%), Postives = 40/53 (75.47%), Query Frame = 0
BLAST of CsaV3_4G031450.1 vs. TrEMBL
Match: tr|A0A200QP69|A0A200QP69_9MAGN (Uncharacterized protein OS=Macleaya cordata OX=56857 GN=BVC80_1779g40 PE=4 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 8.3e-05 Identity = 30/56 (53.57%), Postives = 42/56 (75.00%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
|