CsaV3_1G001100.1 (mRNA) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.AATGTCCATGTTTCTTGCTTGGAGGAATCCGGTTCAGAGGATGAGACATCAGTGAGGGTTAAGCGTTTGGAGGACATGTGTGGGAGAAGTAGACTTGTGTTCTTTAGAGGGGTTGCTACTGTTGTTACTAAGTTGTTCAATATTGTGGAACTCGATGTTGCAGTGTTTGGAAAGAAGGATTATCAGCAATGGCTAGATTATCAGGCGGATG AATGTCCATGTTTCTTGCTTGGAGGAATCCGGTTCAGAGGATGAGACATCAGTGAGGGTTAAGCGTTTGGAGGACATGTGTGGGAGAAGTAGACTTGTGTTCTTTAGAGGGGTTGCTACTGTTGTTACTAAGTTGTTCAATATTGTGGAACTCGATGTTGCAGTGTTTGGAAAGAAGGATTATCAGCAATGGCTAGATTATCAGGCGGATG AATGTCCATGTTTCTTGCTTGGAGGAATCCGGTTCAGAGGATGAGACATCAGTGAGGGTTAAGCGTTTGGAGGACATGTGTGGGAGAAGTAGACTTGTGTTCTTTAGAGGGGTTGCTACTGTTGTTACTAAGTTGTTCAATATTGTGGAACTCGATGTTGCAGTGTTTGGAAAGAAGGATTATCAGCAATGGCTAGATTATCAGGCGGATG NVHVSCLEESGSEDETSVRVKRLEDMCGRSRLVFFRGVATVVTKLFNIVELDVAVFGKKDYQQWLDYQADX
BLAST of CsaV3_1G001100.1 vs. NCBI nr
Match: KGN43706.1 (hypothetical protein Csa_7G061730 [Cucumis sativus]) HSP 1 Score: 114.4 bits (285), Expect = 1.6e-22 Identity = 59/63 (93.65%), Postives = 60/63 (95.24%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. NCBI nr
Match: XP_022931128.1 (pantoate--beta-alanine ligase-like [Cucurbita moschata]) HSP 1 Score: 102.8 bits (255), Expect = 4.8e-19 Identity = 53/61 (86.89%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. NCBI nr
Match: XP_022996300.1 (pantoate--beta-alanine ligase-like [Cucurbita maxima]) HSP 1 Score: 102.4 bits (254), Expect = 6.3e-19 Identity = 52/61 (85.25%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. NCBI nr
Match: XP_023533404.1 (pantoate--beta-alanine ligase-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 100.1 bits (248), Expect = 3.1e-18 Identity = 52/61 (85.25%), Postives = 54/61 (88.52%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. NCBI nr
Match: KGN58349.1 (hypothetical protein Csa_3G625640 [Cucumis sativus]) HSP 1 Score: 99.0 bits (245), Expect = 6.9e-18 Identity = 52/62 (83.87%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. TAIR10
Match: AT5G48840.1 (homolog of bacterial PANC) HSP 1 Score: 92.0 bits (227), Expect = 1.5e-19 Identity = 46/62 (74.19%), Postives = 52/62 (83.87%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. Swiss-Prot
Match: sp|Q9FKB3|PANC_ARATH (Pantoate--beta-alanine ligase OS=Arabidopsis thaliana OX=3702 GN=At5g48840 PE=1 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 2.8e-18 Identity = 46/62 (74.19%), Postives = 52/62 (83.87%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. Swiss-Prot
Match: sp|O24210|PANC_ORYSJ (Pantoate--beta-alanine ligase OS=Oryza sativa subsp. japonica OX=39947 GN=PANC PE=2 SV=2) HSP 1 Score: 89.7 bits (221), Expect = 1.4e-17 Identity = 47/63 (74.60%), Postives = 53/63 (84.13%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. Swiss-Prot
Match: sp|O24035|PANC_LOTJA (Pantoate--beta-alanine ligase OS=Lotus japonicus OX=34305 GN=PANC PE=1 SV=3) HSP 1 Score: 85.5 bits (210), Expect = 2.6e-16 Identity = 45/63 (71.43%), Postives = 52/63 (82.54%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. Swiss-Prot
Match: sp|B8CTC7|PANC_SHEPW (Pantothenate synthetase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) OX=225849 GN=panC PE=3 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 6.2e-10 Identity = 34/62 (54.84%), Postives = 43/62 (69.35%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. Swiss-Prot
Match: sp|B8EDX3|PANC_SHEB2 (Pantothenate synthetase OS=Shewanella baltica (strain OS223) OX=407976 GN=panC PE=3 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 8.1e-10 Identity = 34/56 (60.71%), Postives = 40/56 (71.43%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. TrEMBL
Match: tr|A0A0A0K7A9|A0A0A0K7A9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G061730 PE=4 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.1e-22 Identity = 59/63 (93.65%), Postives = 60/63 (95.24%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. TrEMBL
Match: tr|A0A0A0LBL8|A0A0A0LBL8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G625640 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 4.6e-18 Identity = 52/62 (83.87%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. TrEMBL
Match: tr|A0A1S3CMZ3|A0A1S3CMZ3_CUCME (pantoate--beta-alanine ligase OS=Cucumis melo OX=3656 GN=LOC103502785 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 6.0e-18 Identity = 51/62 (82.26%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. TrEMBL
Match: tr|A0A0A0KJD2|A0A0A0KJD2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G409330 PE=4 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 7.8e-18 Identity = 51/63 (80.95%), Postives = 55/63 (87.30%), Query Frame = 0
BLAST of CsaV3_1G001100.1 vs. TrEMBL
Match: tr|A0A2K2BNM5|A0A2K2BNM5_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_002G240800v3 PE=3 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 1.3e-17 Identity = 50/62 (80.65%), Postives = 55/62 (88.71%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
|