Csa6G497280.1 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.CAACCATAAAAACTCTCTTTCTAATTCAAACGAACACAAATCCAAATGCTAATATCACATAAAATCTGCTCTGGGTTTTGATCTGCATGAAGTGAAAGATGAGCCAAGGCAAGTATGCTTATCCTTACTACGGTGAAGGTTACTATCAGGGGCCGCCGCCGCCTCCAGTGGTGGCGCCACCACAGTATGCAGCCGCTCCTCCCCAGGGGCCCGGATGCCTGGAGGCTTGGTAATTTCAATCATCTAAACCCCAACCTAATGTTTATAACAACCTAATATTTTCTCTCTATCTTATTTCTCAGTCTTGCTGCTCTGTGCTGCTGCTGTCTTGTTGACCAATGCTGCTGGTGCTGTGATCCATGGTGTCTGTTTGCCATCTAG ATGAGCCAAGGCAAGTATGCTTATCCTTACTACGGTGAAGGTTACTATCAGGGGCCGCCGCCGCCTCCAGTGGTGGCGCCACCACAGTATGCAGCCGCTCCTCCCCAGGGGCCCGGATGCCTGGAGGCTTGTCTTGCTGCTCTGTGCTGCTGCTGTCTTGTTGACCAATGCTGCTGGTGCTGTGATCCATGGTGTCTGTTTGCCATCTAG ATGAGCCAAGGCAAGTATGCTTATCCTTACTACGGTGAAGGTTACTATCAGGGGCCGCCGCCGCCTCCAGTGGTGGCGCCACCACAGTATGCAGCCGCTCCTCCCCAGGGGCCCGGATGCCTGGAGGCTTGTCTTGCTGCTCTGTGCTGCTGCTGTCTTGTTGACCAATGCTGCTGGTGCTGTGATCCATGGTGTCTGTTTGCCATCTAG MSQGKYAYPYYGEGYYQGPPPPPVVAPPQYAAAPPQGPGCLEACLAALCCCCLVDQCCWCCDPWCLFAI*
BLAST of Csa6G497280.1 vs. Swiss-Prot
Match: CYT1A_ARATH (Cysteine-rich and transmembrane domain-containing protein A OS=Arabidopsis thaliana GN=At2g41420 PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 3.6e-07 Identity = 29/58 (50.00%), Postives = 29/58 (50.00%), Query Frame = 1
BLAST of Csa6G497280.1 vs. TrEMBL
Match: A0A0A0KGL9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G497280 PE=4 SV=1) HSP 1 Score: 169.9 bits (429), Expect = 1.1e-39 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Csa6G497280.1 vs. TrEMBL
Match: A0A061DHF5_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_000918 PE=4 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 3.8e-19 Identity = 47/68 (69.12%), Postives = 53/68 (77.94%), Query Frame = 1
BLAST of Csa6G497280.1 vs. TrEMBL
Match: A0A0A9HH94_ARUDO (Uncharacterized protein OS=Arundo donax PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 4.9e-19 Identity = 48/69 (69.57%), Postives = 53/69 (76.81%), Query Frame = 1
BLAST of Csa6G497280.1 vs. TrEMBL
Match: U5D7A4_AMBTC (Uncharacterized protein OS=Amborella trichopoda GN=AMTR_s00046p00231970 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.1e-18 Identity = 45/67 (67.16%), Postives = 51/67 (76.12%), Query Frame = 1
BLAST of Csa6G497280.1 vs. TrEMBL
Match: A0A0A9IXJ4_ARUDO (Uncharacterized protein OS=Arundo donax PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.1e-18 Identity = 48/69 (69.57%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Csa6G497280.1 vs. TAIR10
Match: AT4G33660.1 (AT4G33660.1 unknown protein) HSP 1 Score: 82.4 bits (202), Expect = 1.2e-16 Identity = 41/72 (56.94%), Postives = 40/72 (55.56%), Query Frame = 1
BLAST of Csa6G497280.1 vs. TAIR10
Match: AT5G67600.1 (AT5G67600.1 unknown protein) HSP 1 Score: 56.2 bits (134), Expect = 9.2e-09 Identity = 30/55 (54.55%), Postives = 31/55 (56.36%), Query Frame = 1
BLAST of Csa6G497280.1 vs. TAIR10
Match: AT2G41420.1 (AT2G41420.1 proline-rich family protein) HSP 1 Score: 55.1 bits (131), Expect = 2.1e-08 Identity = 29/58 (50.00%), Postives = 29/58 (50.00%), Query Frame = 1
BLAST of Csa6G497280.1 vs. TAIR10
Match: AT2G32190.1 (AT2G32190.1 unknown protein) HSP 1 Score: 47.0 bits (110), Expect = 5.6e-06 Identity = 25/62 (40.32%), Postives = 28/62 (45.16%), Query Frame = 1
BLAST of Csa6G497280.1 vs. NCBI nr
Match: gi|700193474|gb|KGN48678.1| (hypothetical protein Csa_6G497280 [Cucumis sativus]) HSP 1 Score: 169.9 bits (429), Expect = 1.6e-39 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Csa6G497280.1 vs. NCBI nr
Match: gi|590706350|ref|XP_007047698.1| (Uncharacterized protein TCM_000918 [Theobroma cacao]) HSP 1 Score: 101.7 bits (252), Expect = 5.4e-19 Identity = 47/68 (69.12%), Postives = 53/68 (77.94%), Query Frame = 1
BLAST of Csa6G497280.1 vs. NCBI nr
Match: gi|548860514|gb|ERN18100.1| (hypothetical protein AMTR_s00046p00231970 [Amborella trichopoda]) HSP 1 Score: 100.1 bits (248), Expect = 1.6e-18 Identity = 45/67 (67.16%), Postives = 51/67 (76.12%), Query Frame = 1
BLAST of Csa6G497280.1 vs. NCBI nr
Match: gi|728826639|gb|KHG06826.1| (hypothetical protein F383_33724 [Gossypium arboreum]) HSP 1 Score: 99.8 bits (247), Expect = 2.1e-18 Identity = 47/68 (69.12%), Postives = 52/68 (76.47%), Query Frame = 1
BLAST of Csa6G497280.1 vs. NCBI nr
Match: gi|944222203|gb|KQK86607.1| (hypothetical protein SETIT_037590mg [Setaria italica]) HSP 1 Score: 99.4 bits (246), Expect = 2.7e-18 Identity = 46/69 (66.67%), Postives = 53/69 (76.81%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|