Csa6G364110.1 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAAAAGGTAAGATCTATAGTTTTCTAATTTGGAGATTGTGGAGGAACTTATTGTAATTTTGAAGTATTTTGATAACGTGAACTACATCTCTTGTTTGTGAGTTTTAGTTTGGATACATTTAAATATTGATCGGCTTCCCATGCTTAGACCGCATAGTTTGATGGTTTAGGTTAACATATATAATACATGGCATATAGTTATAGGTTAGTCTCTAAGAAAAGCGATAGACCACCTTTTGATTCAAAGGGAGAAGAGGCAAAAATTGGAACAAAAATATCATTTGATTCGTCAATCCTTAAAAAACGAAATCGTTGAGTGAGAAATGGAAAATTCATGGAAAGTTACAATCCCCACCGCGTAATAGTGCACCCACACGTCTTCATCGATGTTTTTTAACCGGAAGACCGAGAGCAAACTATCAAGACCTTGGGTTCTCTGGACACATACTTCGTGAAATGGTTCATGCATGCTTGTTGCTTGGGATGACAATGAAGAATATTATTCTATTGTTCTAA ATGGAAAAAGCGATAGACCACCTTTTGATTCAAAGGGAGAAGAGGCAAAAATTGGAACAAAAATATCATTTGATTCGTCAATCCTTAAAAAACGAAATCGTTGATGCACCCACACGTCTTCATCGATGTTTTTTAACCGGAAGACCGAGAGCAAACTATCAAGACCTTGGGTTCTCTGGACACATACTTCGTGAAATGGTTCATGCATGCTTGTTGCTTGGGATGACAATGAAGAATATTATTCTATTGTTCTAA ATGGAAAAAGCGATAGACCACCTTTTGATTCAAAGGGAGAAGAGGCAAAAATTGGAACAAAAATATCATTTGATTCGTCAATCCTTAAAAAACGAAATCGTTGATGCACCCACACGTCTTCATCGATGTTTTTTAACCGGAAGACCGAGAGCAAACTATCAAGACCTTGGGTTCTCTGGACACATACTTCGTGAAATGGTTCATGCATGCTTGTTGCTTGGGATGACAATGAAGAATATTATTCTATTGTTCTAA MEKAIDHLLIQREKRQKLEQKYHLIRQSLKNEIVDAPTRLHRCFLTGRPRANYQDLGFSGHILREMVHACLLLGMTMKNIILLF*
BLAST of Csa6G364110.1 vs. Swiss-Prot
Match: RR14_CUCSA (30S ribosomal protein S14, chloroplastic OS=Cucumis sativus GN=rps14 PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 3.7e-22 Identity = 61/91 (67.03%), Postives = 60/91 (65.93%), Query Frame = 1
BLAST of Csa6G364110.1 vs. Swiss-Prot
Match: RR14_FAGEA (30S ribosomal protein S14, chloroplastic OS=Fagopyrum esculentum subsp. ancestrale GN=rps14 PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 4.6e-20 Identity = 57/91 (62.64%), Postives = 58/91 (63.74%), Query Frame = 1
BLAST of Csa6G364110.1 vs. Swiss-Prot
Match: RR14_SOLBU (30S ribosomal protein S14, chloroplastic OS=Solanum bulbocastanum GN=rps14 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.3e-19 Identity = 57/91 (62.64%), Postives = 57/91 (62.64%), Query Frame = 1
BLAST of Csa6G364110.1 vs. Swiss-Prot
Match: RR14_NICTO (30S ribosomal protein S14, chloroplastic OS=Nicotiana tomentosiformis GN=rps14 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.3e-19 Identity = 57/91 (62.64%), Postives = 57/91 (62.64%), Query Frame = 1
BLAST of Csa6G364110.1 vs. Swiss-Prot
Match: RR14_TOBAC (30S ribosomal protein S14, chloroplastic OS=Nicotiana tabacum GN=rps14 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.3e-19 Identity = 57/91 (62.64%), Postives = 57/91 (62.64%), Query Frame = 1
BLAST of Csa6G364110.1 vs. TrEMBL
Match: A0A0A0KIM2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G364110 PE=4 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 2.8e-40 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of Csa6G364110.1 vs. TrEMBL
Match: W8E1Z5_9ROSI (Ribosomal protein S14 OS=Cucumis hystrix GN=rps14 PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 4.2e-20 Identity = 61/91 (67.03%), Postives = 62/91 (68.13%), Query Frame = 1
BLAST of Csa6G364110.1 vs. TrEMBL
Match: H2BCB6_9CARY (30S ribosomal protein S14 (Fragment) OS=Didierea madagascariensis GN=rps14 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 6.0e-19 Identity = 59/91 (64.84%), Postives = 61/91 (67.03%), Query Frame = 1
BLAST of Csa6G364110.1 vs. TrEMBL
Match: H2BCB4_9CARY (30S ribosomal protein S14 (Fragment) OS=Anredera baselloides GN=rps14 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 6.0e-19 Identity = 59/91 (64.84%), Postives = 61/91 (67.03%), Query Frame = 1
BLAST of Csa6G364110.1 vs. TrEMBL
Match: H2BCC2_POROL (30S ribosomal protein S14 (Fragment) OS=Portulaca oleracea GN=rps14 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 6.0e-19 Identity = 59/91 (64.84%), Postives = 61/91 (67.03%), Query Frame = 1
BLAST of Csa6G364110.1 vs. TAIR10
Match: ATCG00330.1 (ATCG00330.1 chloroplast ribosomal protein S14) HSP 1 Score: 90.5 bits (223), Expect = 5.4e-19 Identity = 51/91 (56.04%), Postives = 55/91 (60.44%), Query Frame = 1
BLAST of Csa6G364110.1 vs. NCBI nr
Match: gi|700192402|gb|KGN47606.1| (hypothetical protein Csa_6G364110 [Cucumis sativus]) HSP 1 Score: 172.2 bits (435), Expect = 4.0e-40 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of Csa6G364110.1 vs. NCBI nr
Match: gi|68164801|ref|YP_247597.1| (ribosomal protein S14 [Cucumis sativus]) HSP 1 Score: 105.1 bits (261), Expect = 6.0e-20 Identity = 61/91 (67.03%), Postives = 62/91 (68.13%), Query Frame = 1
BLAST of Csa6G364110.1 vs. NCBI nr
Match: gi|595645609|gb|AHM89066.1| (ribosomal protein S14 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 101.3 bits (251), Expect = 8.6e-19 Identity = 59/91 (64.84%), Postives = 61/91 (67.03%), Query Frame = 1
BLAST of Csa6G364110.1 vs. NCBI nr
Match: gi|372000855|gb|AEX65504.1| (30S ribosomal protein S14, partial (chloroplast) [Didierea madagascariensis]) HSP 1 Score: 101.3 bits (251), Expect = 8.6e-19 Identity = 59/91 (64.84%), Postives = 61/91 (67.03%), Query Frame = 1
BLAST of Csa6G364110.1 vs. NCBI nr
Match: gi|372000851|gb|AEX65502.1| (30S ribosomal protein S14, partial (chloroplast) [Anredera baselloides]) HSP 1 Score: 101.3 bits (251), Expect = 8.6e-19 Identity = 59/91 (64.84%), Postives = 61/91 (67.03%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|