Csa4G286980.1 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCAGAGATGGCATTGAAATCCCTCCCTCTTCTCACGACATTCTTAAATTTAATATAATCGCCACACTTAATTCATCAAATGATCAACCCGCCCCACCTTCTGTTGATCAGTCAAATATCATTCAACCGGACAGCACCAAACTTAGATTCCCTCCACCTGAGAGTCTCAAGAGTGAGTATAAATATTTTTGTATTAAAAAGTTCTTATTTTACATCAAGTATCATTGATGTTAATTTGATTAGACTTCAATTTCCAGGAGACAAGTTTCTTTGGCTTAGTGATGGTGAATTTGCAAGACAAACACTTGCTGGTCTCAACCCTTATTGTATACAGTTGGTCAAGGTGAGTGACGATTGA ATGTTCAGAGATGGCATTGAAATCCCTCCCTCTTCTCACGACATTCTTAAATTTAATATAATCGCCACACTTAATTCATCAAATGATCAACCCGCCCCACCTTCTGTTGATCAGTCAAATATCATTCAACCGGACAGCACCAAACTTAGATTCCCTCCACCTGAGAGTCTCAAGAGAGACAAGTTTCTTTGGCTTAGTGATGGTGAATTTGCAAGACAAACACTTGCTGGTCTCAACCCTTATTGTATACAGTTGGTCAAGGTGAGTGACGATTGA ATGTTCAGAGATGGCATTGAAATCCCTCCCTCTTCTCACGACATTCTTAAATTTAATATAATCGCCACACTTAATTCATCAAATGATCAACCCGCCCCACCTTCTGTTGATCAGTCAAATATCATTCAACCGGACAGCACCAAACTTAGATTCCCTCCACCTGAGAGTCTCAAGAGAGACAAGTTTCTTTGGCTTAGTGATGGTGAATTTGCAAGACAAACACTTGCTGGTCTCAACCCTTATTGTATACAGTTGGTCAAGGTGAGTGACGATTGA MFRDGIEIPPSSHDILKFNIIATLNSSNDQPAPPSVDQSNIIQPDSTKLRFPPPESLKRDKFLWLSDGEFARQTLAGLNPYCIQLVKVSDD*
BLAST of Csa4G286980.1 vs. Swiss-Prot
Match: LOX23_HORVU (Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare GN=LOX2.3 PE=1 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.8e-09 Identity = 40/86 (46.51%), Postives = 48/86 (55.81%), Query Frame = 1
BLAST of Csa4G286980.1 vs. Swiss-Prot
Match: LOXC1_ORYSJ (Lipoxygenase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX1 PE=2 SV=2) HSP 1 Score: 60.8 bits (146), Expect = 8.7e-09 Identity = 34/88 (38.64%), Postives = 46/88 (52.27%), Query Frame = 1
BLAST of Csa4G286980.1 vs. Swiss-Prot
Match: LOX2_ARATH (Lipoxygenase 2, chloroplastic OS=Arabidopsis thaliana GN=LOX2 PE=1 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.6e-07 Identity = 26/39 (66.67%), Postives = 28/39 (71.79%), Query Frame = 1
BLAST of Csa4G286980.1 vs. Swiss-Prot
Match: LOXC2_ORYSJ (Probable lipoxygenase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX2 PE=2 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.2e-07 Identity = 31/87 (35.63%), Postives = 46/87 (52.87%), Query Frame = 1
BLAST of Csa4G286980.1 vs. Swiss-Prot
Match: LOX21_SOLTU (Linoleate 13S-lipoxygenase 2-1, chloroplastic OS=Solanum tuberosum GN=LOX2.1 PE=1 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.1e-06 Identity = 25/38 (65.79%), Postives = 27/38 (71.05%), Query Frame = 1
BLAST of Csa4G286980.1 vs. TrEMBL
Match: A0A0A0KWX7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G286980 PE=4 SV=1) HSP 1 Score: 188.7 bits (478), Expect = 3.1e-45 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 1
BLAST of Csa4G286980.1 vs. TrEMBL
Match: A0A0A0L1U9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G286940 PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 4.2e-26 Identity = 60/91 (65.93%), Postives = 76/91 (83.52%), Query Frame = 1
BLAST of Csa4G286980.1 vs. TrEMBL
Match: A0A0A0KX68_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G286960 PE=4 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.6e-25 Identity = 61/87 (70.11%), Postives = 73/87 (83.91%), Query Frame = 1
BLAST of Csa4G286980.1 vs. TrEMBL
Match: A0A0A0L1V5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G287530 PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 6.3e-14 Identity = 42/86 (48.84%), Postives = 56/86 (65.12%), Query Frame = 1
BLAST of Csa4G286980.1 vs. TrEMBL
Match: A0A0A0KX73_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G287550 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 5.0e-11 Identity = 41/72 (56.94%), Postives = 49/72 (68.06%), Query Frame = 1
BLAST of Csa4G286980.1 vs. TAIR10
Match: AT3G45140.1 (AT3G45140.1 lipoxygenase 2) HSP 1 Score: 56.6 bits (135), Expect = 9.3e-09 Identity = 26/39 (66.67%), Postives = 28/39 (71.79%), Query Frame = 1
BLAST of Csa4G286980.1 vs. TAIR10
Match: AT1G55020.1 (AT1G55020.1 lipoxygenase 1) HSP 1 Score: 52.4 bits (124), Expect = 1.8e-07 Identity = 26/48 (54.17%), Postives = 31/48 (64.58%), Query Frame = 1
BLAST of Csa4G286980.1 vs. TAIR10
Match: AT1G67560.1 (AT1G67560.1 PLAT/LH2 domain-containing lipoxygenase family protein) HSP 1 Score: 49.3 bits (116), Expect = 1.5e-06 Identity = 22/49 (44.90%), Postives = 29/49 (59.18%), Query Frame = 1
BLAST of Csa4G286980.1 vs. TAIR10
Match: AT1G17420.1 (AT1G17420.1 lipoxygenase 3) HSP 1 Score: 46.6 bits (109), Expect = 9.6e-06 Identity = 23/45 (51.11%), Postives = 29/45 (64.44%), Query Frame = 1
BLAST of Csa4G286980.1 vs. NCBI nr
Match: gi|700198967|gb|KGN54125.1| (hypothetical protein Csa_4G286980 [Cucumis sativus]) HSP 1 Score: 188.7 bits (478), Expect = 4.4e-45 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 1
BLAST of Csa4G286980.1 vs. NCBI nr
Match: gi|778693090|ref|XP_011653577.1| (PREDICTED: linoleate 13S-lipoxygenase 2-1, chloroplastic-like [Cucumis sativus]) HSP 1 Score: 181.0 bits (458), Expect = 9.3e-43 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 1
BLAST of Csa4G286980.1 vs. NCBI nr
Match: gi|659097673|ref|XP_008449751.1| (PREDICTED: linoleate 13S-lipoxygenase 2-1, chloroplastic-like isoform X2 [Cucumis melo]) HSP 1 Score: 134.0 bits (336), Expect = 1.3e-28 Identity = 70/87 (80.46%), Postives = 77/87 (88.51%), Query Frame = 1
BLAST of Csa4G286980.1 vs. NCBI nr
Match: gi|659097675|ref|XP_008449752.1| (PREDICTED: linoleate 13S-lipoxygenase 2-1, chloroplastic-like isoform X3 [Cucumis melo]) HSP 1 Score: 134.0 bits (336), Expect = 1.3e-28 Identity = 70/87 (80.46%), Postives = 77/87 (88.51%), Query Frame = 1
BLAST of Csa4G286980.1 vs. NCBI nr
Match: gi|659097671|ref|XP_008449750.1| (PREDICTED: linoleate 13S-lipoxygenase 2-1, chloroplastic-like isoform X1 [Cucumis melo]) HSP 1 Score: 134.0 bits (336), Expect = 1.3e-28 Identity = 70/87 (80.46%), Postives = 77/87 (88.51%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|