Csa3G197920.1 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACGCACTGAAGTACATCTGGGAAGGTGCAATTCCATTACAGATTCATCTCCATGAATCTGAAGTCACCACCGTCCCTCCTCCACCACCTGCAATGGTAATTCTCTGCTTTTCCCCTTCTGCTGCACTTTCCCTTTTCGAACTATCTGATTTTAGGCTCTCAATTTCATCAACCGATGAACATCATGGGTTCATTCTTTTCATTTCTCTGAGAAATTTGAGTTTGTTTACAAGGGCTGCTAGTATTTGCTGCTTCTTGTGTTTTCAATTTGGTGTTTTGAATGACGGATGCTTTTTATGTGTCTACTGAACGCCCAAGTAGAACTTTTGATTGAGCTTAATCGAATTGAATTGCTTTTTATGTGGGATTTTGTTTTTTGAGCTCCTTTAGGTCTTAGCTCCTCGGATTGGCTACCTGCCTCTGTTGGCTTCTCAGATTAAACCTTACTTCGGTAGCACGCTTCCTCCTGGAGTTGACACCATCTGGTTTGAGTACCAGGGTTTGCCCCTTAAATGGTACGCTCTTCTTTGCTGCTTTAAATTTCATCTTTGCTAA ATGGACGCACTGAAGTACATCTGGGAAGGTGCAATTCCATTACAGATTCATCTCCATGAATCTGAAGTCACCACCGTCCCTCCTCCACCACCTGCAATGGTCTTAGCTCCTCGGATTGGCTACCTGCCTCTGTTGGCTTCTCAGATTAAACCTTACTTCGGTAGCACGCTTCCTCCTGGAGTTGACACCATCTGGTTTGAGTACCAGGGTTTGCCCCTTAAATGGTACGCTCTTCTTTGCTGCTTTAAATTTCATCTTTGCTAA ATGGACGCACTGAAGTACATCTGGGAAGGTGCAATTCCATTACAGATTCATCTCCATGAATCTGAAGTCACCACCGTCCCTCCTCCACCACCTGCAATGGTCTTAGCTCCTCGGATTGGCTACCTGCCTCTGTTGGCTTCTCAGATTAAACCTTACTTCGGTAGCACGCTTCCTCCTGGAGTTGACACCATCTGGTTTGAGTACCAGGGTTTGCCCCTTAAATGGTACGCTCTTCTTTGCTGCTTTAAATTTCATCTTTGCTAA MDALKYIWEGAIPLQIHLHESEVTTVPPPPPAMVLAPRIGYLPLLASQIKPYFGSTLPPGVDTIWFEYQGLPLKWYALLCCFKFHLC*
BLAST of Csa3G197920.1 vs. Swiss-Prot
Match: ATG5_ARATH (Autophagy protein 5 OS=Arabidopsis thaliana GN=ATG5 PE=2 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 9.5e-29 Identity = 54/75 (72.00%), Postives = 63/75 (84.00%), Query Frame = 1
BLAST of Csa3G197920.1 vs. Swiss-Prot
Match: ATG5_ORYSI (Autophagy protein 5 OS=Oryza sativa subsp. indica GN=ATG5 PE=3 SV=2) HSP 1 Score: 124.8 bits (312), Expect = 4.7e-28 Identity = 50/75 (66.67%), Postives = 62/75 (82.67%), Query Frame = 1
BLAST of Csa3G197920.1 vs. Swiss-Prot
Match: ATG5_ORYSJ (Autophagy protein 5 OS=Oryza sativa subsp. japonica GN=ATG5 PE=2 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 4.7e-28 Identity = 50/75 (66.67%), Postives = 62/75 (82.67%), Query Frame = 1
BLAST of Csa3G197920.1 vs. Swiss-Prot
Match: ATG5_DICDI (Autophagy protein 5 OS=Dictyostelium discoideum GN=atg5 PE=3 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 8.1e-12 Identity = 31/75 (41.33%), Postives = 44/75 (58.67%), Query Frame = 1
BLAST of Csa3G197920.1 vs. Swiss-Prot
Match: ATG5_EMENI (Autophagy protein 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg5 PE=3 SV=2) HSP 1 Score: 62.0 bits (149), Expect = 3.8e-09 Identity = 31/76 (40.79%), Postives = 42/76 (55.26%), Query Frame = 1
BLAST of Csa3G197920.1 vs. TrEMBL
Match: A0A0A0LA41_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G197920 PE=4 SV=1) HSP 1 Score: 192.2 bits (487), Expect = 2.7e-46 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 1
BLAST of Csa3G197920.1 vs. TrEMBL
Match: V4U4U7_9ROSI (Autophagy protein 5 OS=Citrus clementina GN=CICLE_v10005246mg PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.2e-33 Identity = 65/76 (85.53%), Postives = 72/76 (94.74%), Query Frame = 1
BLAST of Csa3G197920.1 vs. TrEMBL
Match: V4RJI1_9ROSI (Autophagy protein 5 OS=Citrus clementina GN=CICLE_v10005246mg PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.2e-33 Identity = 65/76 (85.53%), Postives = 72/76 (94.74%), Query Frame = 1
BLAST of Csa3G197920.1 vs. TrEMBL
Match: V4S1S6_9ROSI (Autophagy protein 5 OS=Citrus clementina GN=CICLE_v10005246mg PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.2e-33 Identity = 65/76 (85.53%), Postives = 72/76 (94.74%), Query Frame = 1
BLAST of Csa3G197920.1 vs. TrEMBL
Match: A0A067E9E3_CITSI (Autophagy protein 5 (Fragment) OS=Citrus sinensis GN=CISIN_1g035508mg PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.2e-33 Identity = 65/76 (85.53%), Postives = 72/76 (94.74%), Query Frame = 1
BLAST of Csa3G197920.1 vs. TAIR10
Match: AT5G17290.1 (AT5G17290.1 autophagy protein Apg5 family) HSP 1 Score: 127.1 bits (318), Expect = 5.4e-30 Identity = 54/75 (72.00%), Postives = 63/75 (84.00%), Query Frame = 1
BLAST of Csa3G197920.1 vs. NCBI nr
Match: gi|700202344|gb|KGN57477.1| (hypothetical protein Csa_3G197920 [Cucumis sativus]) HSP 1 Score: 192.2 bits (487), Expect = 3.8e-46 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 1
BLAST of Csa3G197920.1 vs. NCBI nr
Match: gi|449446111|ref|XP_004140815.1| (PREDICTED: autophagy protein 5 isoform X1 [Cucumis sativus]) HSP 1 Score: 163.3 bits (412), Expect = 1.9e-37 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 1
BLAST of Csa3G197920.1 vs. NCBI nr
Match: gi|778679952|ref|XP_011651221.1| (PREDICTED: autophagy protein 5 isoform X2 [Cucumis sativus]) HSP 1 Score: 163.3 bits (412), Expect = 1.9e-37 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 1
BLAST of Csa3G197920.1 vs. NCBI nr
Match: gi|659112386|ref|XP_008456193.1| (PREDICTED: autophagy protein 5 isoform X1 [Cucumis melo]) HSP 1 Score: 163.3 bits (412), Expect = 1.9e-37 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 1
BLAST of Csa3G197920.1 vs. NCBI nr
Match: gi|659112388|ref|XP_008456194.1| (PREDICTED: autophagy protein 5 isoform X2 [Cucumis melo]) HSP 1 Score: 163.3 bits (412), Expect = 1.9e-37 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|