Csa3G187290.1 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTTGGCTAGGAAAAGACGACATTGGTAGTCACCTACTACAAGCACGGTAGAGGTTTGATTAAGATCAATGGCCTCCCAATTGAACTTGTAGACCCGAAGATCCTCCATTCAAGGCTTATGAGCCTATCCTCCTCCTTGGATGACACAGGTTCTCTGGTGTCGATATGCGTATCAGAGTAAAGGGTGGTCACACCTTGCAGATTTACGCCATCCGCCAGAGTATCGCCAAGGCCTTGGTCGCGTTCTACCAGAAGTACGTGGACGAGCAGACCAAGAAGAAAATCGAAGACATTCTTGTCAGGTTCGACAGGACTTTACTCGTCGTCGATCCCTGA ATGTTTTGGCTAGGAAAAGACGACATTGGTAGTCACCTACTACAAGCACGGTTCTCTGGTGTCGATATGCGTATCAGAGTAAAGGGTGGTCACACCTTGCAGATTTACGCCATCCGCCAGAGTATCGCCAAGGCCTTGGTCGCGTTCTACCAGAAGTACGTGGACGAGCAGACCAAGAAGAAAATCGAAGACATTCTTGTCAGGTTCGACAGGACTTTACTCGTCGTCGATCCCTGA ATGTTTTGGCTAGGAAAAGACGACATTGGTAGTCACCTACTACAAGCACGGTTCTCTGGTGTCGATATGCGTATCAGAGTAAAGGGTGGTCACACCTTGCAGATTTACGCCATCCGCCAGAGTATCGCCAAGGCCTTGGTCGCGTTCTACCAGAAGTACGTGGACGAGCAGACCAAGAAGAAAATCGAAGACATTCTTGTCAGGTTCGACAGGACTTTACTCGTCGTCGATCCCTGA MFWLGKDDIGSHLLQARFSGVDMRIRVKGGHTLQIYAIRQSIAKALVAFYQKYVDEQTKKKIEDILVRFDRTLLVVDP*
BLAST of Csa3G187290.1 vs. Swiss-Prot
Match: RS16_LUPPO (40S ribosomal protein S16 OS=Lupinus polyphyllus GN=RPS16 PE=2 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.1e-23 Identity = 55/65 (84.62%), Postives = 60/65 (92.31%), Query Frame = 1
BLAST of Csa3G187290.1 vs. Swiss-Prot
Match: RS16_GOSHI (40S ribosomal protein S16 OS=Gossypium hirsutum GN=RPS16 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 3.5e-22 Identity = 54/63 (85.71%), Postives = 57/63 (90.48%), Query Frame = 1
BLAST of Csa3G187290.1 vs. Swiss-Prot
Match: RS161_ARATH (40S ribosomal protein S16-1 OS=Arabidopsis thaliana GN=RPS16A PE=2 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.7e-21 Identity = 53/71 (74.65%), Postives = 60/71 (84.51%), Query Frame = 1
BLAST of Csa3G187290.1 vs. Swiss-Prot
Match: RS163_ARATH (40S ribosomal protein S16-3 OS=Arabidopsis thaliana GN=RPS16C PE=2 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.7e-21 Identity = 53/71 (74.65%), Postives = 60/71 (84.51%), Query Frame = 1
BLAST of Csa3G187290.1 vs. Swiss-Prot
Match: RS16_TORRU (40S ribosomal protein S16 OS=Tortula ruralis GN=RPS16 PE=2 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 8.5e-21 Identity = 49/65 (75.38%), Postives = 60/65 (92.31%), Query Frame = 1
BLAST of Csa3G187290.1 vs. TrEMBL
Match: A0A0A0L661_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G187290 PE=4 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 8.6e-36 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 1
BLAST of Csa3G187290.1 vs. TrEMBL
Match: A0A0V0H547_SOLCH (Putative ovule protein OS=Solanum chacoense PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.7e-21 Identity = 55/63 (87.30%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of Csa3G187290.1 vs. TrEMBL
Match: M0ZY89_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400004124 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.7e-21 Identity = 55/63 (87.30%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of Csa3G187290.1 vs. TrEMBL
Match: A0A0A0L6F6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G202730 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.7e-21 Identity = 56/63 (88.89%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of Csa3G187290.1 vs. TrEMBL
Match: K4BW97_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.7e-21 Identity = 55/63 (87.30%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of Csa3G187290.1 vs. TAIR10
Match: AT2G09990.1 (AT2G09990.1 Ribosomal protein S5 domain 2-like superfamily protein) HSP 1 Score: 102.8 bits (255), Expect = 9.7e-23 Identity = 53/71 (74.65%), Postives = 60/71 (84.51%), Query Frame = 1
BLAST of Csa3G187290.1 vs. TAIR10
Match: AT5G18380.1 (AT5G18380.1 Ribosomal protein S5 domain 2-like superfamily protein) HSP 1 Score: 102.8 bits (255), Expect = 9.7e-23 Identity = 53/71 (74.65%), Postives = 60/71 (84.51%), Query Frame = 1
BLAST of Csa3G187290.1 vs. TAIR10
Match: AT3G04230.1 (AT3G04230.1 Ribosomal protein S5 domain 2-like superfamily protein) HSP 1 Score: 97.4 bits (241), Expect = 4.1e-21 Identity = 50/71 (70.42%), Postives = 59/71 (83.10%), Query Frame = 1
BLAST of Csa3G187290.1 vs. NCBI nr
Match: gi|700202322|gb|KGN57455.1| (hypothetical protein Csa_3G187290 [Cucumis sativus]) HSP 1 Score: 157.1 bits (396), Expect = 1.2e-35 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 1
BLAST of Csa3G187290.1 vs. NCBI nr
Match: gi|460385974|ref|XP_004238675.1| (PREDICTED: 40S ribosomal protein S16 [Solanum lycopersicum]) HSP 1 Score: 109.0 bits (271), Expect = 3.8e-21 Identity = 55/63 (87.30%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of Csa3G187290.1 vs. NCBI nr
Match: gi|527203164|gb|EPS69719.1| (hypothetical protein M569_05046, partial [Genlisea aurea]) HSP 1 Score: 109.0 bits (271), Expect = 3.8e-21 Identity = 56/63 (88.89%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of Csa3G187290.1 vs. NCBI nr
Match: gi|527194037|gb|EPS63821.1| (hypothetical protein M569_10962, partial [Genlisea aurea]) HSP 1 Score: 109.0 bits (271), Expect = 3.8e-21 Identity = 56/63 (88.89%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of Csa3G187290.1 vs. NCBI nr
Match: gi|449438394|ref|XP_004136973.1| (PREDICTED: 40S ribosomal protein S16 [Cucumis sativus]) HSP 1 Score: 109.0 bits (271), Expect = 3.8e-21 Identity = 56/63 (88.89%), Postives = 60/63 (95.24%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|