Csa2G258790.1 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.CTCATTTTAAGTACTATTTCCTCTTCTAGATTGCTCTTACCAATCAGATCAGAACTTTAGATCTTTTTGACAGCCTTTCATCTCAAGAAAATGGGGATTCGTTTTCTATCTTTGGTTCCTCATGTCAAGCAAATTCTGAAGATGCAGTCAGGTTTAACCAAAAAACAGTTGGGTGTTCCAAAAGGCCATGTTGCCGTTTATGTGGGAGAGATTCAAATGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACGATCTGTCGTTCCAGCAACTGCTCAGCTACGCAGAGGAAGAGTTTGGATTCCATCATCCTCAAGGGGGCCTAACAATCCCTTGCAAAGAAGATGCCTTCGTTGATCTCACTTCTAAATTGCAAGTATCTTGAAGGATGAACAGCAGAGCACAAATTGCCATTTTTTTACAACCTTTTCTGGTTGTTTCTGACTCTTTTTGTTTTTTTGACTCGTAATAGAATTTTGTAGAATGGAATGCCCTTATTGCCTGTAAATGAATGCCATACGGTGCATTTACCAACAGAAATTAATTAAAAGGATACACAAATTTACC ATGGGGATTCGTTTTCTATCTTTGGTTCCTCATGTCAAGCAAATTCTGAAGATGCAGTCAGGTTTAACCAAAAAACAGTTGGGTGTTCCAAAAGGCCATGTTGCCGTTTATGTGGGAGAGATTCAAATGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACGATCTGTCGTTCCAGCAACTGCTCAGCTACGCAGAGGAAGAGTTTGGATTCCATCATCCTCAAGGGGGCCTAACAATCCCTTGCAAAGAAGATGCCTTCGTTGATCTCACTTCTAAATTGCAAGTATCTTGA ATGGGGATTCGTTTTCTATCTTTGGTTCCTCATGTCAAGCAAATTCTGAAGATGCAGTCAGGTTTAACCAAAAAACAGTTGGGTGTTCCAAAAGGCCATGTTGCCGTTTATGTGGGAGAGATTCAAATGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACGATCTGTCGTTCCAGCAACTGCTCAGCTACGCAGAGGAAGAGTTTGGATTCCATCATCCTCAAGGGGGCCTAACAATCCCTTGCAAAGAAGATGCCTTCGTTGATCTCACTTCTAAATTGCAAGTATCTTGA MGIRFLSLVPHVKQILKMQSGLTKKQLGVPKGHVAVYVGEIQMKRFVVPISYLNDLSFQQLLSYAEEEFGFHHPQGGLTIPCKEDAFVDLTSKLQVS*
BLAST of Csa2G258790.1 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 3.6e-21 Identity = 50/83 (60.24%), Postives = 59/83 (71.08%), Query Frame = 1
BLAST of Csa2G258790.1 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 6.2e-21 Identity = 49/79 (62.03%), Postives = 56/79 (70.89%), Query Frame = 1
BLAST of Csa2G258790.1 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 6.2e-21 Identity = 50/90 (55.56%), Postives = 62/90 (68.89%), Query Frame = 1
BLAST of Csa2G258790.1 vs. Swiss-Prot
Match: SAU19_ARATH (Auxin-responsive protein SAUR19 OS=Arabidopsis thaliana GN=SAUR19 PE=2 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 2.4e-20 Identity = 48/79 (60.76%), Postives = 57/79 (72.15%), Query Frame = 1
BLAST of Csa2G258790.1 vs. Swiss-Prot
Match: AX6B_SOYBN (Auxin-induced protein 6B OS=Glycine max PE=2 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 2.4e-20 Identity = 51/94 (54.26%), Postives = 64/94 (68.09%), Query Frame = 1
BLAST of Csa2G258790.1 vs. TrEMBL
Match: A0A0A0LJA3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258790 PE=4 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 1.6e-47 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa2G258790.1 vs. TrEMBL
Match: A0A0A0LPI0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258720 PE=4 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 8.4e-41 Identity = 85/97 (87.63%), Postives = 88/97 (90.72%), Query Frame = 1
BLAST of Csa2G258790.1 vs. TrEMBL
Match: A0A0A0LLF1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258700 PE=4 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 6.0e-39 Identity = 82/97 (84.54%), Postives = 87/97 (89.69%), Query Frame = 1
BLAST of Csa2G258790.1 vs. TrEMBL
Match: A0A0A0LJ99_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258740 PE=4 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 1.9e-37 Identity = 79/97 (81.44%), Postives = 85/97 (87.63%), Query Frame = 1
BLAST of Csa2G258790.1 vs. TrEMBL
Match: A0A0A0LIZ9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258760 PE=4 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.3e-37 Identity = 78/97 (80.41%), Postives = 87/97 (89.69%), Query Frame = 1
BLAST of Csa2G258790.1 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 107.8 bits (268), Expect = 3.7e-24 Identity = 55/97 (56.70%), Postives = 66/97 (68.04%), Query Frame = 1
BLAST of Csa2G258790.1 vs. TAIR10
Match: AT4G34810.1 (AT4G34810.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 103.6 bits (257), Expect = 7.1e-23 Identity = 57/105 (54.29%), Postives = 71/105 (67.62%), Query Frame = 1
BLAST of Csa2G258790.1 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 103.2 bits (256), Expect = 9.2e-23 Identity = 53/98 (54.08%), Postives = 66/98 (67.35%), Query Frame = 1
BLAST of Csa2G258790.1 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 102.1 bits (253), Expect = 2.1e-22 Identity = 50/83 (60.24%), Postives = 59/83 (71.08%), Query Frame = 1
BLAST of Csa2G258790.1 vs. TAIR10
Match: AT5G18020.1 (AT5G18020.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 101.3 bits (251), Expect = 3.5e-22 Identity = 49/79 (62.03%), Postives = 56/79 (70.89%), Query Frame = 1
BLAST of Csa2G258790.1 vs. NCBI nr
Match: gi|700206764|gb|KGN61883.1| (hypothetical protein Csa_2G258790 [Cucumis sativus]) HSP 1 Score: 196.4 bits (498), Expect = 2.3e-47 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa2G258790.1 vs. NCBI nr
Match: gi|700206757|gb|KGN61876.1| (hypothetical protein Csa_2G258720 [Cucumis sativus]) HSP 1 Score: 174.1 bits (440), Expect = 1.2e-40 Identity = 85/97 (87.63%), Postives = 88/97 (90.72%), Query Frame = 1
BLAST of Csa2G258790.1 vs. NCBI nr
Match: gi|659115596|ref|XP_008457635.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 174.1 bits (440), Expect = 1.2e-40 Identity = 85/97 (87.63%), Postives = 88/97 (90.72%), Query Frame = 1
BLAST of Csa2G258790.1 vs. NCBI nr
Match: gi|659115592|ref|XP_008457632.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 171.4 bits (433), Expect = 7.8e-40 Identity = 84/97 (86.60%), Postives = 88/97 (90.72%), Query Frame = 1
BLAST of Csa2G258790.1 vs. NCBI nr
Match: gi|778674175|ref|XP_011650154.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 167.9 bits (424), Expect = 8.6e-39 Identity = 82/97 (84.54%), Postives = 87/97 (89.69%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|