Csa2G258700.1 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGATTCGCTTGCTATCTTTGGTTCCCCATGCCAAGCAAATCCTGAAGATTCAGTCAGGACTTACCAAAAACCAGTTGGATGTTCCAAAAGGGCATGTAGCAGTTTATGTGGGAGAGATTCAAAGGAAACGGTTCGTGGTTCCAATATCTTACTTAAACCATCCGTCATTCAAACAACTGCTCTGCCACGCAGAAGAAGAGTTCGGTTTCCATCATCCTCAAGGGGGCCTAACAATTCCTTGCAAAGAAGATGCCTTTACTGAAATCACTTCTAAATTGCAAGCATCTTGAAGGATGAAGAAAAAATGGCAATATTTCATTTTTTGACCATTTGTTTTTCAAAATTTTCTCTATTCACTTGCCTTTTGACTTGCAAGAGAATATACTCCATTGTTAGCCATAGCCTATAAATGAGTAGCATTGTAAAGTACTGTTTACCAACAAAAGTAGATGTATGCACATACAGCAACAATTCAGAATCAATTCCCATGTAG ATGGGGATTCGCTTGCTATCTTTGGTTCCCCATGCCAAGCAAATCCTGAAGATTCAGTCAGGACTTACCAAAAACCAGTTGGATGTTCCAAAAGGGCATGTAGCAGTTTATGTGGGAGAGATTCAAAGGAAACGGTTCGTGGTTCCAATATCTTACTTAAACCATCCGTCATTCAAACAACTGCTCTGCCACGCAGAAGAAGAGTTCGGTTTCCATCATCCTCAAGGGGGCCTAACAATTCCTTGCAAAGAAGATGCCTTTACTGAAATCACTTCTAAATTGCAAGCATCTTGA ATGGGGATTCGCTTGCTATCTTTGGTTCCCCATGCCAAGCAAATCCTGAAGATTCAGTCAGGACTTACCAAAAACCAGTTGGATGTTCCAAAAGGGCATGTAGCAGTTTATGTGGGAGAGATTCAAAGGAAACGGTTCGTGGTTCCAATATCTTACTTAAACCATCCGTCATTCAAACAACTGCTCTGCCACGCAGAAGAAGAGTTCGGTTTCCATCATCCTCAAGGGGGCCTAACAATTCCTTGCAAAGAAGATGCCTTTACTGAAATCACTTCTAAATTGCAAGCATCTTGA MGIRLLSLVPHAKQILKIQSGLTKNQLDVPKGHVAVYVGEIQRKRFVVPISYLNHPSFKQLLCHAEEEFGFHHPQGGLTIPCKEDAFTEITSKLQAS*
BLAST of Csa2G258700.1 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.1e-21 Identity = 50/84 (59.52%), Postives = 59/84 (70.24%), Query Frame = 1
BLAST of Csa2G258700.1 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 3.6e-21 Identity = 49/79 (62.03%), Postives = 55/79 (69.62%), Query Frame = 1
BLAST of Csa2G258700.1 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 6.2e-21 Identity = 48/79 (60.76%), Postives = 56/79 (70.89%), Query Frame = 1
BLAST of Csa2G258700.1 vs. Swiss-Prot
Match: ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata GN=ARG7 PE=2 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 8.1e-21 Identity = 52/96 (54.17%), Postives = 62/96 (64.58%), Query Frame = 1
BLAST of Csa2G258700.1 vs. Swiss-Prot
Match: SAU19_ARATH (Auxin-responsive protein SAUR19 OS=Arabidopsis thaliana GN=SAUR19 PE=2 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.4e-20 Identity = 48/79 (60.76%), Postives = 56/79 (70.89%), Query Frame = 1
BLAST of Csa2G258700.1 vs. TrEMBL
Match: A0A0A0LLF1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258700 PE=4 SV=1) HSP 1 Score: 199.9 bits (507), Expect = 1.4e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa2G258700.1 vs. TrEMBL
Match: A0A0A0LPI0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258720 PE=4 SV=1) HSP 1 Score: 175.3 bits (443), Expect = 3.8e-41 Identity = 83/97 (85.57%), Postives = 90/97 (92.78%), Query Frame = 1
BLAST of Csa2G258700.1 vs. TrEMBL
Match: A0A0A0LIZ9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258760 PE=4 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 2.4e-40 Identity = 82/97 (84.54%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of Csa2G258700.1 vs. TrEMBL
Match: A0A0A0LJA3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258790 PE=4 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 6.0e-39 Identity = 82/97 (84.54%), Postives = 87/97 (89.69%), Query Frame = 1
BLAST of Csa2G258700.1 vs. TrEMBL
Match: A0A0A0LJ99_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258740 PE=4 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 5.1e-38 Identity = 77/97 (79.38%), Postives = 87/97 (89.69%), Query Frame = 1
BLAST of Csa2G258700.1 vs. TAIR10
Match: AT4G34810.1 (AT4G34810.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 112.8 bits (281), Expect = 1.2e-25 Identity = 59/105 (56.19%), Postives = 73/105 (69.52%), Query Frame = 1
BLAST of Csa2G258700.1 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 109.0 bits (271), Expect = 1.7e-24 Identity = 53/98 (54.08%), Postives = 71/98 (72.45%), Query Frame = 1
BLAST of Csa2G258700.1 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 108.6 bits (270), Expect = 2.2e-24 Identity = 53/97 (54.64%), Postives = 68/97 (70.10%), Query Frame = 1
BLAST of Csa2G258700.1 vs. TAIR10
Match: AT4G34790.1 (AT4G34790.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 106.7 bits (265), Expect = 8.3e-24 Identity = 58/107 (54.21%), Postives = 71/107 (66.36%), Query Frame = 1
BLAST of Csa2G258700.1 vs. TAIR10
Match: AT4G34770.1 (AT4G34770.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.9 bits (263), Expect = 1.4e-23 Identity = 63/107 (58.88%), Postives = 68/107 (63.55%), Query Frame = 1
BLAST of Csa2G258700.1 vs. NCBI nr
Match: gi|778674175|ref|XP_011650154.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 199.9 bits (507), Expect = 2.1e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
BLAST of Csa2G258700.1 vs. NCBI nr
Match: gi|659115596|ref|XP_008457635.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 177.9 bits (450), Expect = 8.3e-42 Identity = 84/97 (86.60%), Postives = 91/97 (93.81%), Query Frame = 1
BLAST of Csa2G258700.1 vs. NCBI nr
Match: gi|700206757|gb|KGN61876.1| (hypothetical protein Csa_2G258720 [Cucumis sativus]) HSP 1 Score: 175.3 bits (443), Expect = 5.4e-41 Identity = 83/97 (85.57%), Postives = 90/97 (92.78%), Query Frame = 1
BLAST of Csa2G258700.1 vs. NCBI nr
Match: gi|700206761|gb|KGN61880.1| (hypothetical protein Csa_2G258760 [Cucumis sativus]) HSP 1 Score: 172.6 bits (436), Expect = 3.5e-40 Identity = 82/97 (84.54%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of Csa2G258700.1 vs. NCBI nr
Match: gi|659115592|ref|XP_008457632.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 171.4 bits (433), Expect = 7.8e-40 Identity = 82/97 (84.54%), Postives = 90/97 (92.78%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|