Csa1G169960.1 (mRNA) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGGGGATTAGGGGCTGCATGGAAGGTGTTTGATGGAATGCACGATAGGAATGAGGTGTTGCGATCGGTTTTGATTGGGAGATTGGGGCAAGTGGAAGAAGAAGAGAAGTTGATAATGGAGATGGAGGTCGAGCCTGATAAGGGTTTGTGGGGTGCCATGTTGAGTGCTTGTAGGATTCATGGGAAGGCCGACGTTGCTGATAGGGTTCAAAAACGGTTTATGAAACAACAATGA ATGCGGGGATTAGGGGCTGCATGGAAGGTGTTTGATGGAATGCACGATAGGAATGAGGTGTTGCGATCGGTTTTGATTGGGAGATTGGGGCAAGTGGAAGAAGAAGAGAAGTTGATAATGGAGATGGAGGTCGAGCCTGATAAGGGTTTGTGGGGTGCCATGTTGAGTGCTTGTAGGATTCATGGGAAGGCCGACGTTGCTGATAGGGTTCAAAAACGGTTTATGAAACAACAATGA ATGCGGGGATTAGGGGCTGCATGGAAGGTGTTTGATGGAATGCACGATAGGAATGAGGTGTTGCGATCGGTTTTGATTGGGAGATTGGGGCAAGTGGAAGAAGAAGAGAAGTTGATAATGGAGATGGAGGTCGAGCCTGATAAGGGTTTGTGGGGTGCCATGTTGAGTGCTTGTAGGATTCATGGGAAGGCCGACGTTGCTGATAGGGTTCAAAAACGGTTTATGAAACAACAATGA MRGLGAAWKVFDGMHDRNEVLRSVLIGRLGQVEEEEKLIMEMEVEPDKGLWGAMLSACRIHGKADVADRVQKRFMKQQ*
BLAST of Csa1G169960.1 vs. Swiss-Prot
Match: PPR45_ARATH (Pentatricopeptide repeat-containing protein At1g15510, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H73 PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 5.4e-07 Identity = 22/44 (50.00%), Postives = 30/44 (68.18%), Query Frame = 1
BLAST of Csa1G169960.1 vs. Swiss-Prot
Match: PP265_ARATH (Pentatricopeptide repeat-containing protein At3g46790, chloroplastic OS=Arabidopsis thaliana GN=CRR2 PE=2 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.2e-06 Identity = 19/49 (38.78%), Postives = 32/49 (65.31%), Query Frame = 1
BLAST of Csa1G169960.1 vs. Swiss-Prot
Match: PP417_ARATH (Pentatricopeptide repeat-containing protein At5g44230 OS=Arabidopsis thaliana GN=PCMP-H17 PE=2 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.6e-06 Identity = 22/44 (50.00%), Postives = 30/44 (68.18%), Query Frame = 1
BLAST of Csa1G169960.1 vs. Swiss-Prot
Match: PP348_ARATH (Pentatricopeptide repeat-containing protein At4g33990 OS=Arabidopsis thaliana GN=EMB2758 PE=3 SV=2) HSP 1 Score: 53.1 bits (126), Expect = 1.6e-06 Identity = 21/42 (50.00%), Postives = 27/42 (64.29%), Query Frame = 1
BLAST of Csa1G169960.1 vs. Swiss-Prot
Match: PP297_ARATH (Pentatricopeptide repeat-containing protein At4g01030, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H65 PE=3 SV=2) HSP 1 Score: 52.8 bits (125), Expect = 2.0e-06 Identity = 26/74 (35.14%), Postives = 39/74 (52.70%), Query Frame = 1
BLAST of Csa1G169960.1 vs. TrEMBL
Match: A0A0A0LVX2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G169960 PE=4 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 7.7e-37 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 1
BLAST of Csa1G169960.1 vs. TrEMBL
Match: A0A0A0K1F7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G041310 PE=4 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 3.6e-18 Identity = 46/54 (85.19%), Postives = 50/54 (92.59%), Query Frame = 1
BLAST of Csa1G169960.1 vs. TrEMBL
Match: A0A0A0K1F7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G041310 PE=4 SV=1) HSP 1 Score: 38.9 bits (89), Expect = 3.4e+00 Identity = 26/65 (40.00%), Postives = 38/65 (58.46%), Query Frame = 1
HSP 2 Score: 74.7 bits (182), Expect = 5.6e-11 Identity = 32/49 (65.31%), Postives = 43/49 (87.76%), Query Frame = 1
BLAST of Csa1G169960.1 vs. TrEMBL
Match: W9RYT7_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_014506 PE=4 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 5.6e-11 Identity = 33/54 (61.11%), Postives = 45/54 (83.33%), Query Frame = 1
BLAST of Csa1G169960.1 vs. TrEMBL
Match: A0A0B2RTT8_GLYSO (Pentatricopeptide repeat-containing protein OS=Glycine soja GN=glysoja_001226 PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 2.1e-10 Identity = 30/49 (61.22%), Postives = 42/49 (85.71%), Query Frame = 1
BLAST of Csa1G169960.1 vs. TAIR10
Match: AT1G15510.1 (AT1G15510.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 54.7 bits (130), Expect = 3.0e-08 Identity = 22/44 (50.00%), Postives = 30/44 (68.18%), Query Frame = 1
BLAST of Csa1G169960.1 vs. TAIR10
Match: AT3G46790.1 (AT3G46790.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 53.5 bits (127), Expect = 6.8e-08 Identity = 19/49 (38.78%), Postives = 32/49 (65.31%), Query Frame = 1
BLAST of Csa1G169960.1 vs. TAIR10
Match: AT4G33990.1 (AT4G33990.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 53.1 bits (126), Expect = 8.8e-08 Identity = 21/42 (50.00%), Postives = 27/42 (64.29%), Query Frame = 1
BLAST of Csa1G169960.1 vs. TAIR10
Match: AT5G44230.1 (AT5G44230.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 53.1 bits (126), Expect = 8.8e-08 Identity = 22/44 (50.00%), Postives = 30/44 (68.18%), Query Frame = 1
BLAST of Csa1G169960.1 vs. TAIR10
Match: AT4G01030.1 (AT4G01030.1 pentatricopeptide (PPR) repeat-containing protein) HSP 1 Score: 52.8 bits (125), Expect = 1.2e-07 Identity = 26/74 (35.14%), Postives = 39/74 (52.70%), Query Frame = 1
BLAST of Csa1G169960.1 vs. NCBI nr
Match: gi|700209876|gb|KGN64972.1| (hypothetical protein Csa_1G169960 [Cucumis sativus]) HSP 1 Score: 160.6 bits (405), Expect = 1.1e-36 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 1
BLAST of Csa1G169960.1 vs. NCBI nr
Match: gi|659110920|ref|XP_008455480.1| (PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis melo]) HSP 1 Score: 99.0 bits (245), Expect = 4.0e-18 Identity = 46/54 (85.19%), Postives = 51/54 (94.44%), Query Frame = 1
BLAST of Csa1G169960.1 vs. NCBI nr
Match: gi|449453543|ref|XP_004144516.1| (PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus]) HSP 1 Score: 98.6 bits (244), Expect = 5.2e-18 Identity = 46/54 (85.19%), Postives = 50/54 (92.59%), Query Frame = 1
BLAST of Csa1G169960.1 vs. NCBI nr
Match: gi|449453543|ref|XP_004144516.1| (PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus]) HSP 1 Score: 38.9 bits (89), Expect = 4.9e+00 Identity = 26/65 (40.00%), Postives = 38/65 (58.46%), Query Frame = 1
HSP 2 Score: 74.7 bits (182), Expect = 8.0e-11 Identity = 33/54 (61.11%), Postives = 45/54 (83.33%), Query Frame = 1
BLAST of Csa1G169960.1 vs. NCBI nr
Match: gi|593699138|ref|XP_007150034.1| (hypothetical protein PHAVU_005G120500g [Phaseolus vulgaris]) HSP 1 Score: 74.7 bits (182), Expect = 8.0e-11 Identity = 32/49 (65.31%), Postives = 43/49 (87.76%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
|