CsGy3G033410.1 (mRNA) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGATAACCTCCGCCACCGCAAGGAATCATTCGCAATTGCGAGGGCCAAGGCCACCGCCATTGACGGTTAACAAATCCAGCTCCACTAACATTTCCAAGAAATCAACGAAGAATAATCCTCTTCCGATTTCGAATCAACGCCATCGCCGTTCTCCGATAATCATTTACCTTCGATCCCCAAAGGTCATCCATGTTCGGCCTGAGGAGTTCAAAAGCTTCGTTCAACGTCTCACTGGAAATCGATCCTCTGTAGCCGTCGTCGCCTCATCCTGTTCTGCTACTGGAATGATTAATGATGAGGAATTTGTATCCGTGTGCAATTGCATTCCGTCGTAG ATGATGATAACCTCCGCCACCGCAAGGAATCATTCGCAATTGCGAGGGCCAAGGCCACCGCCATTGACGGTTAACAAATCCAGCTCCACTAACATTTCCAAGAAATCAACGAAGAATAATCCTCTTCCGATTTCGAATCAACGCCATCGCCGTTCTCCGATAATCATTTACCTTCGATCCCCAAAGGTCATCCATGTTCGGCCTGAGGAGTTCAAAAGCTTCGTTCAACGTCTCACTGGAAATCGATCCTCTGTAGCCGTCGTCGCCTCATCCTGTTCTGCTACTGGAATGATTAATGATGAGGAATTTGTATCCGTGTGCAATTGCATTCCGTCGTAG ATGATGATAACCTCCGCCACCGCAAGGAATCATTCGCAATTGCGAGGGCCAAGGCCACCGCCATTGACGGTTAACAAATCCAGCTCCACTAACATTTCCAAGAAATCAACGAAGAATAATCCTCTTCCGATTTCGAATCAACGCCATCGCCGTTCTCCGATAATCATTTACCTTCGATCCCCAAAGGTCATCCATGTTCGGCCTGAGGAGTTCAAAAGCTTCGTTCAACGTCTCACTGGAAATCGATCCTCTGTAGCCGTCGTCGCCTCATCCTGTTCTGCTACTGGAATGATTAATGATGAGGAATTTGTATCCGTGTGCAATTGCATTCCGTCGTAG MMITSATARNHSQLRGPRPPPLTVNKSSSTNISKKSTKNNPLPISNQRHRRSPIIIYLRSPKVIHVRPEEFKSFVQRLTGNRSSVAVVASSCSATGMINDEEFVSVCNCIPS
BLAST of CsGy3G033410.1 vs. NCBI nr
Match: KGN59247.1 (hypothetical protein Csa_3G785410 [Cucumis sativus]) HSP 1 Score: 216.9 bits (551), Expect = 3.6e-53 Identity = 111/112 (99.11%), Postives = 111/112 (99.11%), Query Frame = 0
BLAST of CsGy3G033410.1 vs. NCBI nr
Match: XP_008443599.1 (PREDICTED: protein MKS1-like [Cucumis melo]) HSP 1 Score: 100.5 bits (249), Expect = 3.8e-18 Identity = 65/108 (60.19%), Postives = 66/108 (61.11%), Query Frame = 0
BLAST of CsGy3G033410.1 vs. NCBI nr
Match: OMO95035.1 (VQ motif-containing protein [Corchorus capsularis]) HSP 1 Score: 77.8 bits (190), Expect = 2.6e-11 Identity = 43/86 (50.00%), Postives = 59/86 (68.60%), Query Frame = 0
BLAST of CsGy3G033410.1 vs. NCBI nr
Match: XP_011468538.1 (PREDICTED: uncharacterized protein LOC105352670 [Fragaria vesca subsp. vesca]) HSP 1 Score: 77.0 bits (188), Expect = 4.5e-11 Identity = 46/98 (46.94%), Postives = 62/98 (63.27%), Query Frame = 0
BLAST of CsGy3G033410.1 vs. NCBI nr
Match: XP_010653237.1 (PREDICTED: VQ motif-containing protein 8, chloroplastic [Vitis vinifera]) HSP 1 Score: 75.1 bits (183), Expect = 1.7e-10 Identity = 42/83 (50.60%), Postives = 58/83 (69.88%), Query Frame = 0
BLAST of CsGy3G033410.1 vs. TAIR10
Match: AT1G68450.1 (VQ motif-containing protein) HSP 1 Score: 52.0 bits (123), Expect = 2.8e-07 Identity = 31/69 (44.93%), Postives = 39/69 (56.52%), Query Frame = 0
BLAST of CsGy3G033410.1 vs. TAIR10
Match: AT3G18690.1 (MAP kinase substrate 1) HSP 1 Score: 44.3 bits (103), Expect = 5.8e-05 Identity = 29/75 (38.67%), Postives = 36/75 (48.00%), Query Frame = 0
BLAST of CsGy3G033410.1 vs. TAIR10
Match: AT3G18360.1 (VQ motif-containing protein) HSP 1 Score: 42.4 bits (98), Expect = 2.2e-04 Identity = 24/59 (40.68%), Postives = 36/59 (61.02%), Query Frame = 0
BLAST of CsGy3G033410.1 vs. Swiss-Prot
Match: sp|Q9CA36|VQ8_ARATH (VQ motif-containing protein 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=VQ8 PE=2 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 5.0e-06 Identity = 31/69 (44.93%), Postives = 39/69 (56.52%), Query Frame = 0
BLAST of CsGy3G033410.1 vs. TrEMBL
Match: tr|A0A0A0LEW5|A0A0A0LEW5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G785410 PE=4 SV=1) HSP 1 Score: 216.9 bits (551), Expect = 2.4e-53 Identity = 111/112 (99.11%), Postives = 111/112 (99.11%), Query Frame = 0
BLAST of CsGy3G033410.1 vs. TrEMBL
Match: tr|A0A1S3B975|A0A1S3B975_CUCME (protein MKS1-like OS=Cucumis melo OX=3656 GN=LOC103487155 PE=4 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 2.5e-18 Identity = 65/108 (60.19%), Postives = 66/108 (61.11%), Query Frame = 0
BLAST of CsGy3G033410.1 vs. TrEMBL
Match: tr|A0A2N9GB07|A0A2N9GB07_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS24585 PE=4 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 1.1e-13 Identity = 50/89 (56.18%), Postives = 59/89 (66.29%), Query Frame = 0
BLAST of CsGy3G033410.1 vs. TrEMBL
Match: tr|A0A1R3JJT0|A0A1R3JJT0_COCAP (VQ motif-containing protein OS=Corchorus capsularis OX=210143 GN=CCACVL1_05625 PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 1.7e-11 Identity = 43/86 (50.00%), Postives = 59/86 (68.60%), Query Frame = 0
BLAST of CsGy3G033410.1 vs. TrEMBL
Match: tr|A0A1R3HED5|A0A1R3HED5_9ROSI (VQ motif-containing protein OS=Corchorus olitorius OX=93759 GN=COLO4_29493 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 1.1e-10 Identity = 49/113 (43.36%), Postives = 68/113 (60.18%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
|