CsGy3G017710.1 (mRNA) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTTGGCTAGGAAAAGACGACATTGGTAGTCACCTACTACAAGCACGGTAGAGGTTTGATTAAGATCAATGGCCTCCCAATTGAACTTGTAGACCCGAAGATCCTCCATTCAAGGCTTATGAGCCTATCCTCCTCCTTGGATGACACAGGTTCTCTGGTGTCGATATGCGTATCAGAGTAAAGGGTGGTCACACCTTGCAGATTTACGCCATCCGCCAGAGTATCGCCAAGGCCTTGGTCGCGTTCTACCAGAAGTACGTGGACGAGCAGACCAAGAAGAAAATCGAAGACATTCTTGTCAGGTTCGACAGGACTTTACTCGTCGTCGATCCCTGA ATGTTTTGGCTAGGAAAAGACGACATTGGTAGTCACCTACTACAAGCACGGTTCTCTGGTGTCGATATGCGTATCAGAGTAAAGGGTGGTCACACCTTGCAGATTTACGCCATCCGCCAGAGTATCGCCAAGGCCTTGGTCGCGTTCTACCAGAAGTACGTGGACGAGCAGACCAAGAAGAAAATCGAAGACATTCTTGTCAGGTTCGACAGGACTTTACTCGTCGTCGATCCCTGA ATGTTTTGGCTAGGAAAAGACGACATTGGTAGTCACCTACTACAAGCACGGTTCTCTGGTGTCGATATGCGTATCAGAGTAAAGGGTGGTCACACCTTGCAGATTTACGCCATCCGCCAGAGTATCGCCAAGGCCTTGGTCGCGTTCTACCAGAAGTACGTGGACGAGCAGACCAAGAAGAAAATCGAAGACATTCTTGTCAGGTTCGACAGGACTTTACTCGTCGTCGATCCCTGA MFWLGKDDIGSHLLQARFSGVDMRIRVKGGHTLQIYAIRQSIAKALVAFYQKYVDEQTKKKIEDILVRFDRTLLVVDP
BLAST of CsGy3G017710.1 vs. NCBI nr
Match: KGN57455.1 (hypothetical protein Csa_3G187290 [Cucumis sativus]) HSP 1 Score: 157.1 bits (396), Expect = 2.4e-35 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. NCBI nr
Match: OMO54268.1 (Ribosomal protein S9 [Corchorus olitorius]) HSP 1 Score: 108.6 bits (270), Expect = 9.6e-21 Identity = 56/63 (88.89%), Postives = 60/63 (95.24%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. NCBI nr
Match: XP_004136973.1 (PREDICTED: 40S ribosomal protein S16 [Cucumis sativus] >XP_004140706.1 PREDICTED: 40S ribosomal protein S16 [Cucumis sativus] >XP_004149967.1 PREDICTED: 40S ribosomal protein S16 [Cucumis sativus] >XP_008454961.1 PREDICTED: 40S ribosomal protein S16 [Cucumis melo] >XP_008456099.1 PREDICTED: 40S ribosomal protein S16 [Cucumis melo] >XP_008456141.1 PREDICTED: 40S ribosomal protein S16 [Cucumis melo] >XP_022136342.1 40S ribosomal protein S16 [Momordica charantia] >XP_022149129.1 40S ribosomal protein S16 [Momordica charantia] >XP_022943042.1 40S ribosomal protein S16-like [Cucurbita moschata] >XP_022943043.1 40S ribosomal protein S16-like [Cucurbita moschata] >XP_022952362.1 40S ribosomal protein S16-like [Cucurbita moschata] >XP_022927908.1 40S ribosomal protein S16-like [Cucurbita moschata] >XP_022983243.1 40S ribosomal protein S16-like [Cucurbita maxima] >XP_022972375.1 40S ribosomal protein S16-like [Cucurbita maxima] >XP_023535994.1 40S ribosomal protein S16-like [Cucurbita pepo subsp. pepo] >XP_023553863.1 40S ribosomal protein S16-like [Cucurbita pepo subsp. pepo] >KGN43920.1 hypothetical protein Csa_7G073560 [Cucumis sativus] >KGN57515.1 hypothetical protein Csa_3G202730 [Cucumis sativus] >KGN57574.1 hypothetical protein Csa_3G215620 [Cucumis sativus]) HSP 1 Score: 107.8 bits (268), Expect = 1.6e-20 Identity = 56/63 (88.89%), Postives = 60/63 (95.24%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. NCBI nr
Match: XP_004238675.1 (40S ribosomal protein S16 [Solanum lycopersicum] >XP_006355978.1 PREDICTED: 40S ribosomal protein S16 [Solanum tuberosum] >XP_015074502.1 PREDICTED: 40S ribosomal protein S16 [Solanum pennellii]) HSP 1 Score: 107.8 bits (268), Expect = 1.6e-20 Identity = 55/63 (87.30%), Postives = 60/63 (95.24%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. NCBI nr
Match: EPS63821.1 (hypothetical protein M569_10962, partial [Genlisea aurea]) HSP 1 Score: 107.8 bits (268), Expect = 1.6e-20 Identity = 56/63 (88.89%), Postives = 60/63 (95.24%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. TAIR10
Match: AT2G09990.1 (Ribosomal protein S5 domain 2-like superfamily protein) HSP 1 Score: 102.1 bits (253), Expect = 1.6e-22 Identity = 53/71 (74.65%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. TAIR10
Match: AT5G18380.1 (Ribosomal protein S5 domain 2-like superfamily protein) HSP 1 Score: 102.1 bits (253), Expect = 1.6e-22 Identity = 53/71 (74.65%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. TAIR10
Match: AT3G04230.1 (Ribosomal protein S5 domain 2-like superfamily protein) HSP 1 Score: 96.7 bits (239), Expect = 6.9e-21 Identity = 50/71 (70.42%), Postives = 61/71 (85.92%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. Swiss-Prot
Match: sp|P16149|RS16_LUPPO (40S ribosomal protein S16 OS=Lupinus polyphyllus OX=3874 GN=RPS16 PE=2 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 5.4e-23 Identity = 55/65 (84.62%), Postives = 62/65 (95.38%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. Swiss-Prot
Match: sp|P46293|RS16_GOSHI (40S ribosomal protein S16 OS=Gossypium hirsutum OX=3635 GN=RPS16 PE=2 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 7.8e-22 Identity = 54/63 (85.71%), Postives = 59/63 (93.65%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. Swiss-Prot
Match: sp|Q9SK22|RS161_ARATH (40S ribosomal protein S16-1 OS=Arabidopsis thaliana OX=3702 GN=RPS16A PE=2 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 2.9e-21 Identity = 53/71 (74.65%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. Swiss-Prot
Match: sp|Q42340|RS163_ARATH (40S ribosomal protein S16-3 OS=Arabidopsis thaliana OX=3702 GN=RPS16C PE=2 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 2.9e-21 Identity = 53/71 (74.65%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. Swiss-Prot
Match: sp|Q9XEK7|RS16_TORRU (40S ribosomal protein S16 OS=Tortula ruralis OX=38588 GN=RPS16 PE=2 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.5e-20 Identity = 49/65 (75.38%), Postives = 62/65 (95.38%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. TrEMBL
Match: tr|A0A0A0L661|A0A0A0L661_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G187290 PE=4 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 1.6e-35 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. TrEMBL
Match: tr|A0A1R3G848|A0A1R3G848_9ROSI (Ribosomal protein S9 OS=Corchorus olitorius OX=93759 GN=COLO4_36532 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 6.4e-21 Identity = 56/63 (88.89%), Postives = 60/63 (95.24%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. TrEMBL
Match: tr|I1KM19|I1KM19_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100779794 PE=3 SV=2) HSP 1 Score: 107.8 bits (268), Expect = 1.1e-20 Identity = 55/65 (84.62%), Postives = 62/65 (95.38%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. TrEMBL
Match: tr|I1JE09|I1JE09_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100812117 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.1e-20 Identity = 55/65 (84.62%), Postives = 62/65 (95.38%), Query Frame = 0
BLAST of CsGy3G017710.1 vs. TrEMBL
Match: tr|A0A0A0L6F6|A0A0A0L6F6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G202730 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.1e-20 Identity = 56/63 (88.89%), Postives = 60/63 (95.24%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
|