CsGy2G006240.1 (mRNA) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGATACATTTATACAAAACTTCTACCCCGAGCACACGCAATGGAGCCGTAGACAGTCAAGTAAAATCCAATCCACGAAATAATTTGATCTATGGACAGCATCGTTGTGGTAAAGGTCGTAATGCCAGAGGAATCATTACCGCAGGGCATAGAGGGGGAGGTCATAAGCGTCTATACCGTAAAATCGATTTTCGACGGAATGAAAAAGACATATATGGTAGAAGCATAACGGCCCTATTGTTCCTATGGAGAGAAGAACCTATGATTAGCTTTTCGGGAAATTTCCAAACATAATTATCTTGAATATATTAACTATTTCTTTATTTTCCGATCGCCTGGAAGGGACAAAATGGAGATTCTTAATTATTCGTAATTAATTATTTCTTAATTTATTTTATAGAAATTCCCAAAAATCTCTTCATATACTCAGTCAAACTCGAACCCGGCGCCGGGTTCAAATTGAATTAA ATGGCGATACATTTATACAAAACTTCTACCCCGAGCACACGCAATGGAGCCGTAGACAGTCAAGTAAAATCCAATCCACGAAATAATTTGATCTATGGACAGCATCGTTGTGGTAAAGGTCGTAATGCCAGAGGAATCATTACCGCAGGGCATAGAGGGGGAGGTCATAAGCGTCTATACCGTAAAATCGATTTTCGACGGAATGAAAAAGACATATATGAAATTCCCAAAAATCTCTTCATATACTCAGTCAAACTCGAACCCGGCGCCGGGTTCAAATTGAATTAA ATGGCGATACATTTATACAAAACTTCTACCCCGAGCACACGCAATGGAGCCGTAGACAGTCAAGTAAAATCCAATCCACGAAATAATTTGATCTATGGACAGCATCGTTGTGGTAAAGGTCGTAATGCCAGAGGAATCATTACCGCAGGGCATAGAGGGGGAGGTCATAAGCGTCTATACCGTAAAATCGATTTTCGACGGAATGAAAAAGACATATATGAAATTCCCAAAAATCTCTTCATATACTCAGTCAAACTCGAACCCGGCGCCGGGTTCAAATTGAATTAA MAIHLYKTSTPSTRNGAVDSQVKSNPRNNLIYGQHRCGKGRNARGIITAGHRGGGHKRLYRKIDFRRNEKDIYEIPKNLFIYSVKLEPGAGFKLN
BLAST of CsGy2G006240.1 vs. NCBI nr
Match: YP_009166935.1 (ribosomal protein L2 (chloroplast) [Osyris alba] >ALC75235.1 ribosomal protein L2 (chloroplast) [Osyris alba]) HSP 1 Score: 156.0 bits (393), Expect = 6.4e-35 Identity = 77/99 (77.78%), Postives = 85/99 (85.86%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. NCBI nr
Match: YP_740517.1 (ribosomal protein L2 (chloroplast) [Citrus sinensis] >YP_740541.1 ribosomal protein L2 (chloroplast) [Citrus sinensis] >YP_009059390.1 ribosomal protein L2 (chloroplast) [Citrus aurantiifolia] >YP_009059418.1 ribosomal protein L2 (chloroplast) [Citrus aurantiifolia] >YP_009253688.1 ribosomal protein L2 (chloroplast) [Citrus platymamma] >YP_009253711.1 ribosomal protein L2 (chloroplast) [Citrus platymamma] >YP_009320138.1 ribosomal protein L2 (chloroplast) [Citrus depressa] >YP_009320160.1 ribosomal protein L2 (chloroplast) [Citrus depressa] >YP_009333813.1 ribosomal protein L2 (chloroplast) [Clausena excavata] >YP_009333984.1 ribosomal protein L2 (chloroplast) [Glycosmis pentaphylla] >YP_009353528.1 ribosomal protein L2 (plastid) [Citrus maxima] >YP_009353552.1 ribosomal protein L2 (plastid) [Citrus maxima] >YP_009364797.1 ribosomal protein L2 (plastid) [Citrus reticulata] >YP_009364821.1 ribosomal protein L2 (plastid) [Citrus reticulata] >YP_009365865.1 ribosomal protein L2 (plastid) [Citrus limon] >YP_009365893.1 ribosomal protein L2 (plastid) [Citrus limon] >Q09MB2.1 RecName: Full=50S ribosomal protein L2, chloroplastic >ABI49060.1 ribosomal protein L2 (chloroplast) [Citrus sinensis] >ABI49086.1 ribosomal protein L2 (chloroplast) [Citrus sinensis] >AIL50327.1 ribosomal protein L2 (chloroplast) [Citrus aurantiifolia] >AIL50355.1 ribosomal protein L2 (chloroplast) [Citrus aurantiifolia] >ALI86704.1 ribosomal protein L2 (chloroplast) [Citrus platymamma] >ALI86725.1 ribosomal protein L2 (chloroplast) [Citrus platymamma] >AOZ20767.1 ribosomal protein L2 (chloroplast) [Clausena excavata] >AOZ20938.1 ribosomal protein L2 (chloroplast) [Glycosmis pentaphylla] >BAV89982.1 ribosomal protein L2 (chloroplast) [Citrus depressa] >BAV90005.1 ribosomal protein L2 (chloroplast) [Citrus depressa] >AQX91160.1 ribosomal protein L2 (plastid) [Citrus maxima] >AQX91184.1 ribosomal protein L2 (plastid) [Citrus maxima] >ARI49972.1 ribosomal protein L2 (plastid) [Citrus reticulata] >ARI49996.1 ribosomal protein L2 (plastid) [Citrus reticulata] >ARJ61341.1 ribosomal protein L2 (plastid) [Citrus limon] >ARJ61342.1 ribosomal protein L2 (plastid) [Citrus limon] >BBD74123.1 ribosomal protein L2 (chloroplast) [Citrus depressa] >BBD74147.1 ribosomal protein L2 (chloroplast) [Citrus depressa]) HSP 1 Score: 152.9 bits (385), Expect = 5.4e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. NCBI nr
Match: YP_009107017.1 (ribosomal protein L2 (chloroplast) [Sapindus mukorossi] >YP_009262270.1 ribosomal protein L2 (chloroplast) [Spondias bahiensis] >YP_009262245.1 ribosomal protein L2 (chloroplast) [Spondias bahiensis] >YP_009262356.1 ribosomal protein L2 (chloroplast) [Spondias tuberosa] >YP_009262331.1 ribosomal protein L2 (chloroplast) [Spondias tuberosa] >YP_009383693.1 ribosomal protein L2 (plastid) [Pistacia vera] >YP_009383671.1 ribosomal protein L2 (plastid) [Pistacia vera] >YP_009431536.1 ribosomal protein L2 (chloroplast) [Spondias mombin] >YP_009431514.1 ribosomal protein L2 (chloroplast) [Spondias mombin] >YP_009477759.1 ribosomal protein L2 (chloroplast) [Pistacia weinmaniifolia] >ABV59097.2 ribosomal protein L2 (chloroplast) [Mangifera indica] >AIT96763.1 ribosomal protein L2 (chloroplast) [Sapindus mukorossi] >ANI86739.1 ribosomal protein L2 (chloroplast) [Spondias bahiensis] >ANI86740.1 ribosomal protein L2 (chloroplast) [Spondias bahiensis] >ANI86825.1 ribosomal protein L2 (chloroplast) [Spondias tuberosa] >ANI86826.1 ribosomal protein L2 (chloroplast) [Spondias tuberosa] >ARS43801.1 ribosomal protein L2 (plastid) [Pistacia vera] >ARS43802.1 ribosomal protein L2 (plastid) [Pistacia vera] >ASY95772.1 ribosomal protein L2 (chloroplast) [Spondias mombin] >ASY95773.1 ribosomal protein L2 (chloroplast) [Spondias mombin] >AVN66959.1 ribosomal protein L2 (chloroplast) [Pistacia weinmaniifolia]) HSP 1 Score: 152.9 bits (385), Expect = 5.4e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. NCBI nr
Match: ADM92727.1 (ribosomal protein L2, partial (chloroplast) [Davidia involucrata]) HSP 1 Score: 152.9 bits (385), Expect = 5.4e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. NCBI nr
Match: AEK71414.1 (ribosomal protein L2 (plastid) [Schinus terebinthifolia]) HSP 1 Score: 152.9 bits (385), Expect = 5.4e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. TAIR10
Match: ATCG00830.1 (ribosomal protein L2) HSP 1 Score: 142.1 bits (357), Expect = 1.7e-34 Identity = 69/73 (94.52%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. TAIR10
Match: ATCG01310.1 (ribosomal protein L2) HSP 1 Score: 142.1 bits (357), Expect = 1.7e-34 Identity = 69/73 (94.52%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. Swiss-Prot
Match: sp|Q09MB2|RK2_CITSI (50S ribosomal protein L2, chloroplastic OS=Citrus sinensis OX=2711 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 1.8e-36 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. Swiss-Prot
Match: sp|Q4VZK5|RK2_CUCSA (50S ribosomal protein L2, chloroplastic OS=Cucumis sativus OX=3659 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 1.8e-36 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. Swiss-Prot
Match: sp|Q0ZIX7|RK2_VITVI (50S ribosomal protein L2, chloroplastic OS=Vitis vinifera OX=29760 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 1.5e-35 Identity = 72/73 (98.63%), Postives = 72/73 (98.63%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. Swiss-Prot
Match: sp|Q332R5|RK2_LACSA (50S ribosomal protein L2, chloroplastic OS=Lactuca sativa OX=4236 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 2.0e-35 Identity = 71/73 (97.26%), Postives = 72/73 (98.63%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. Swiss-Prot
Match: sp|A9L9D7|RK2_LEMMI (50S ribosomal protein L2, chloroplastic OS=Lemna minor OX=4472 GN=rpl2 PE=2 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 2.0e-35 Identity = 71/73 (97.26%), Postives = 72/73 (98.63%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. TrEMBL
Match: tr|A0A0M5JBQ9|A0A0M5JBQ9_9MAGN (Ribosomal protein L2 OS=Osyris alba OX=350585 PE=4 SV=1) HSP 1 Score: 156.0 bits (393), Expect = 4.2e-35 Identity = 77/99 (77.78%), Postives = 85/99 (85.86%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. TrEMBL
Match: tr|A0A0S2XIM2|A0A0S2XIM2_9FABA (50S ribosomal protein L2, chloroplastic OS=Leucaena trichandra OX=190760 GN=rpl2 PE=3 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 3.6e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. TrEMBL
Match: tr|A0A158V0P7|A0A158V0P7_9FABA (50S ribosomal protein L2, chloroplastic OS=Prosopis glandulosa OX=102697 GN=rpl2 PE=3 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 3.6e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. TrEMBL
Match: tr|A0A223FXU4|A0A223FXU4_9ROSA (50S ribosomal protein L2, chloroplastic OS=Malus trilobata OX=106570 GN=rpl2 PE=3 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 3.6e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of CsGy2G006240.1 vs. TrEMBL
Match: tr|A0A286KTY1|A0A286KTY1_9ROSI (50S ribosomal protein L2, chloroplastic OS=Gynostemma cardiospermum OX=1739658 GN=rpl2 PE=3 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 3.6e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
|