Cp4.1LG12g04400.1 (mRNA) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTAGTGGGGAGAGAAGCCAAGGGAGCTTCAAGAGCGTCCCAAAGGGCTGTTTGGCTATCAAAGTTGGGCATGAACATGAAGAGAAGCAGCGATTTATAGTCCCTCTCTTCTATTTCAATCACCCTTTGTTCTTGCAGCTACTCAAGCAAGCTGAAGACGAATATGGGTTTCATCAAAAGGGAACCATCACTCTTCCTTGTCATATCCACCAATTTAGGTTTGTTCAAGCCTTGATTGATCAAGAAACCTCCTTCCATCACCAACACCACCACCTCTACGGTCCTTGCTTTAGGGTTTGA ATGGGTAGTGGGGAGAGAAGCCAAGGGAGCTTCAAGAGCGTCCCAAAGGGCTGTTTGGCTATCAAAGTTGGGCATGAACATGAAGAGAAGCAGCGATTTATAGTCCCTCTCTTCTATTTCAATCACCCTTTGTTCTTGCAGCTACTCAAGCAAGCTGAAGACGAATATGGGTTTCATCAAAAGGGAACCATCACTCTTCCTTGTCATATCCACCAATTTAGGTTTGTTCAAGCCTTGATTGATCAAGAAACCTCCTTCCATCACCAACACCACCACCTCTACGGTCCTTGCTTTAGGGTTTGA ATGGGTAGTGGGGAGAGAAGCCAAGGGAGCTTCAAGAGCGTCCCAAAGGGCTGTTTGGCTATCAAAGTTGGGCATGAACATGAAGAGAAGCAGCGATTTATAGTCCCTCTCTTCTATTTCAATCACCCTTTGTTCTTGCAGCTACTCAAGCAAGCTGAAGACGAATATGGGTTTCATCAAAAGGGAACCATCACTCTTCCTTGTCATATCCACCAATTTAGGTTTGTTCAAGCCTTGATTGATCAAGAAACCTCCTTCCATCACCAACACCACCACCTCTACGGTCCTTGCTTTAGGGTTTGA MGSGERSQGSFKSVPKGCLAIKVGHEHEEKQRFIVPLFYFNHPLFLQLLKQAEDEYGFHQKGTITLPCHIHQFRFVQALIDQETSFHHQHHHLYGPCFRV
BLAST of Cp4.1LG12g04400.1 vs. Swiss-Prot
Match: SAU32_ARATH (Auxin-responsive protein SAUR32 OS=Arabidopsis thaliana GN=SAUR32 PE=2 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 2.7e-32 Identity = 73/121 (60.33%), Postives = 86/121 (71.07%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. Swiss-Prot
Match: SAU36_ARATH (Auxin-responsive protein SAUR36 OS=Arabidopsis thaliana GN=SAUR36 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.9e-12 Identity = 35/72 (48.61%), Postives = 47/72 (65.28%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. Swiss-Prot
Match: SAU15_ARATH (Auxin-responsive protein SAUR15 OS=Arabidopsis thaliana GN=SAUR15 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 6.0e-11 Identity = 31/81 (38.27%), Postives = 52/81 (64.20%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.9e-10 Identity = 32/69 (46.38%), Postives = 44/69 (63.77%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. Swiss-Prot
Match: SAU71_ARATH (Auxin-responsive protein SAUR71 OS=Arabidopsis thaliana GN=SAUR71 PE=2 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.5e-09 Identity = 30/67 (44.78%), Postives = 45/67 (67.16%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. TrEMBL
Match: A0A0A0KFM7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G106780 PE=4 SV=1) HSP 1 Score: 186.8 bits (473), Expect = 1.3e-44 Identity = 83/99 (83.84%), Postives = 91/99 (91.92%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. TrEMBL
Match: E5GCM6_CUCME (Auxin-responsive family protein OS=Cucumis melo subsp. melo PE=4 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 8.3e-44 Identity = 84/101 (83.17%), Postives = 92/101 (91.09%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. TrEMBL
Match: A0A0D2QRQ4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G044200 PE=4 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 2.8e-31 Identity = 65/95 (68.42%), Postives = 78/95 (82.11%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. TrEMBL
Match: A0A0A0L5S7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G118740 PE=4 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 4.7e-31 Identity = 65/109 (59.63%), Postives = 81/109 (74.31%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. TrEMBL
Match: A0A087H5P6_ARAAL (Uncharacterized protein OS=Arabis alpina GN=AALP_AA4G258100 PE=4 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 8.0e-31 Identity = 71/116 (61.21%), Postives = 86/116 (74.14%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. TAIR10
Match: AT2G46690.1 (AT2G46690.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 139.0 bits (349), Expect = 1.5e-33 Identity = 73/121 (60.33%), Postives = 86/121 (71.07%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. TAIR10
Match: AT3G61900.1 (AT3G61900.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 125.9 bits (315), Expect = 1.4e-29 Identity = 59/101 (58.42%), Postives = 74/101 (73.27%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. TAIR10
Match: AT4G00880.1 (AT4G00880.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 121.7 bits (304), Expect = 2.6e-28 Identity = 56/98 (57.14%), Postives = 74/98 (75.51%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. TAIR10
Match: AT5G53590.1 (AT5G53590.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 99.8 bits (247), Expect = 1.0e-21 Identity = 45/79 (56.96%), Postives = 58/79 (73.42%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. TAIR10
Match: AT3G60690.1 (AT3G60690.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 80.1 bits (196), Expect = 8.5e-16 Identity = 35/73 (47.95%), Postives = 51/73 (69.86%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. NCBI nr
Match: gi|778712138|ref|XP_011656853.1| (PREDICTED: auxin-induced protein X15 [Cucumis sativus]) HSP 1 Score: 186.8 bits (473), Expect = 1.8e-44 Identity = 83/99 (83.84%), Postives = 91/99 (91.92%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. NCBI nr
Match: gi|307136418|gb|ADN34225.1| (auxin-responsive family protein [Cucumis melo subsp. melo]) HSP 1 Score: 184.1 bits (466), Expect = 1.2e-43 Identity = 84/101 (83.17%), Postives = 92/101 (91.09%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. NCBI nr
Match: gi|659119628|ref|XP_008459757.1| (PREDICTED: indole-3-acetic acid-induced protein ARG7 [Cucumis melo]) HSP 1 Score: 181.4 bits (459), Expect = 7.7e-43 Identity = 83/101 (82.18%), Postives = 91/101 (90.10%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. NCBI nr
Match: gi|823146956|ref|XP_012473385.1| (PREDICTED: auxin-induced protein X15-like [Gossypium raimondii]) HSP 1 Score: 142.5 bits (358), Expect = 4.0e-31 Identity = 65/95 (68.42%), Postives = 78/95 (82.11%), Query Frame = 1
BLAST of Cp4.1LG12g04400.1 vs. NCBI nr
Match: gi|1009142561|ref|XP_015888787.1| (PREDICTED: auxin-responsive protein SAUR32-like [Ziziphus jujuba]) HSP 1 Score: 142.5 bits (358), Expect = 4.0e-31 Identity = 63/96 (65.62%), Postives = 78/96 (81.25%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
|