Cp4.1LG05g05660.1 (mRNA) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTATTTAACAGCTTAATCGTGTTATCGGTTGCTCATTTATCGGCCGATGCATCGCAATGCATTGCACGATCTCCCGATCGCCTCACCAGCCACCAACTTCTTTATGTTCTCTTCAGCTACCCTCTTCAACAGCTCTCTCGCCTCGCCCTCTCTATATGGACCTTCTTATGCGTTCCTCCACCGGGTTCCTTTTACTATTACTACTACTCCTCCGACTACGATTCCTCATCCGAATGA ATGGTATTTAACAGCTTAATCGTGTTATCGGTTGCTCATTTATCGGCCGATGCATCGCAATGCATTGCACGATCTCCCGATCGCCTCACCAGCCACCAACTTCTTTATGTTCTCTTCAGCTACCCTCTTCAACAGCTCTCTCGCCTCGCCCTCTCTATATGGACCTTCTTATGCGTTCCTCCACCGGGTTCCTTTTACTATTACTACTACTCCTCCGACTACGATTCCTCATCCGAATGA ATGGTATTTAACAGCTTAATCGTGTTATCGGTTGCTCATTTATCGGCCGATGCATCGCAATGCATTGCACGATCTCCCGATCGCCTCACCAGCCACCAACTTCTTTATGTTCTCTTCAGCTACCCTCTTCAACAGCTCTCTCGCCTCGCCCTCTCTATATGGACCTTCTTATGCGTTCCTCCACCGGGTTCCTTTTACTATTACTACTACTCCTCCGACTACGATTCCTCATCCGAATGA MVFNSLIVLSVAHLSADASQCIARSPDRLTSHQLLYVLFSYPLQQLSRLALSIWTFLCVPPPGSFYYYYYSSDYDSSSE
BLAST of Cp4.1LG05g05660.1 vs. TrEMBL
Match: A0A0A0L0B8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G268060 PE=4 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 1.0e-25 Identity = 62/75 (82.67%), Postives = 66/75 (88.00%), Query Frame = 1
BLAST of Cp4.1LG05g05660.1 vs. TrEMBL
Match: W9SZJ5_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_019129 PE=4 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 3.6e-18 Identity = 51/78 (65.38%), Postives = 61/78 (78.21%), Query Frame = 1
BLAST of Cp4.1LG05g05660.1 vs. TrEMBL
Match: M5W0H4_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa012539mg PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 6.8e-17 Identity = 50/78 (64.10%), Postives = 62/78 (79.49%), Query Frame = 1
BLAST of Cp4.1LG05g05660.1 vs. TrEMBL
Match: B9GLC9_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0001s04070g PE=4 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.7e-15 Identity = 51/79 (64.56%), Postives = 60/79 (75.95%), Query Frame = 1
BLAST of Cp4.1LG05g05660.1 vs. TrEMBL
Match: A0A067KEB0_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_16243 PE=4 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.4e-14 Identity = 49/81 (60.49%), Postives = 59/81 (72.84%), Query Frame = 1
BLAST of Cp4.1LG05g05660.1 vs. TAIR10
Match: AT1G55365.1 (AT1G55365.1 unknown protein) HSP 1 Score: 63.5 bits (153), Expect = 6.5e-11 Identity = 36/80 (45.00%), Postives = 49/80 (61.25%), Query Frame = 1
BLAST of Cp4.1LG05g05660.1 vs. TAIR10
Match: AT5G56520.1 (AT5G56520.1 unknown protein) HSP 1 Score: 58.2 bits (139), Expect = 2.7e-09 Identity = 30/69 (43.48%), Postives = 44/69 (63.77%), Query Frame = 1
BLAST of Cp4.1LG05g05660.1 vs. NCBI nr
Match: gi|659097940|ref|XP_008449890.1| (PREDICTED: uncharacterized protein LOC103491633 [Cucumis melo]) HSP 1 Score: 131.0 bits (328), Expect = 9.4e-28 Identity = 66/78 (84.62%), Postives = 71/78 (91.03%), Query Frame = 1
BLAST of Cp4.1LG05g05660.1 vs. NCBI nr
Match: gi|700198864|gb|KGN54022.1| (hypothetical protein Csa_4G268060 [Cucumis sativus]) HSP 1 Score: 123.6 bits (309), Expect = 1.5e-25 Identity = 62/75 (82.67%), Postives = 66/75 (88.00%), Query Frame = 1
BLAST of Cp4.1LG05g05660.1 vs. NCBI nr
Match: gi|1009124014|ref|XP_015878844.1| (PREDICTED: uncharacterized protein LOC107415082 [Ziziphus jujuba]) HSP 1 Score: 103.2 bits (256), Expect = 2.1e-19 Identity = 51/78 (65.38%), Postives = 63/78 (80.77%), Query Frame = 1
BLAST of Cp4.1LG05g05660.1 vs. NCBI nr
Match: gi|703160992|ref|XP_010112675.1| (hypothetical protein L484_019129 [Morus notabilis]) HSP 1 Score: 98.6 bits (244), Expect = 5.2e-18 Identity = 51/78 (65.38%), Postives = 61/78 (78.21%), Query Frame = 1
BLAST of Cp4.1LG05g05660.1 vs. NCBI nr
Match: gi|657951143|ref|XP_008351351.1| (PREDICTED: uncharacterized protein LOC103414759 [Malus domestica]) HSP 1 Score: 97.1 bits (240), Expect = 1.5e-17 Identity = 51/78 (65.38%), Postives = 62/78 (79.49%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
|